KEGG   Archaeoglobus fulgidus DSM 4304: AF2055Help
Entry
AF2055            CDS       T00011                                 

Gene name
vorG
Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AF2055 (vorG)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AF2055 (vorG)
   00020 Citrate cycle (TCA cycle)
    AF2055 (vorG)
   00620 Pyruvate metabolism
    AF2055 (vorG)
   00640 Propanoate metabolism
    AF2055 (vorG)
   00650 Butanoate metabolism
    AF2055 (vorG)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AF2055 (vorG)
   00680 Methane metabolism
    AF2055 (vorG)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AF2055 (vorG)
Enzymes [BR:afu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     AF2055 (vorG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1852709..1853227)
Genome map
AA seq 172 aa AA seqDB search
MLLEISIYCRGGQGGVTAARILAATAMLQGYYSQSMPQFGPERRGAEVRAFLRISDERIR
RKCPITYPDVVILFDLKLSFNGNPETVVVNCNGSSFTGHGNVFALDATEITRRYGLVNAG
WPILGPAMAGTAAKALDLDPRCLLEAIRLELGDKADRSVKAAEEAYRVVECV
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcttttggaaatatcaatatactgcagaggaggccaggggggcgttactgcggcaagg
attctcgcagcgactgcaatgttacagggttactacagccaatcaatgccgcagtttggc
cctgaaagaaggggagcggaggtaagggcttttttaagaatttctgacgaaagaataagg
agaaaatgcccgattacttaccctgacgttgttattctttttgacttaaaattgagcttt
aatggtaatcctgaaaccgttgtggttaactgcaacggctcctcgttcacaggtcacgga
aacgttttcgcgctcgatgcaactgagataacccgaaggtacgggcttgtaaatgctggc
tggccgatcctaggcccggccatggcgggtactgcagcgaaagccctggacctcgacccc
aggtgccttctggaggcaataaggctcgagctgggtgataaggctgatagaagtgtgaag
gccgcagaggaggcctacagggtggtcgaatgcgtttag

DBGET integrated database retrieval system