KEGG   Archaeoglobus fulgidus: AF2281Help
Entry
AF2281            CDS       T00011                                 

Gene name
aor-4
Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
afu  Archaeoglobus fulgidus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AF2281 (aor-4)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AF2281 (aor-4)
Enzymes [BR:afu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     AF2281 (aor-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2042971..2044812
Genome map
AA seq 613 aa AA seqDB search
MAGGYMGKILKVNLSEGSIKELPIDEEIARKYLGGKGYAVRLLYDYLTEYERLGIAPEDI
DPLGEENVLIFATGPATGVIGFPEPGRYHVMTLRSPLTGGIGSANSGGRFGPYMKFAGYD
MIIVEGKSEEPVYLEVIDGSAEIKCAKDLWGKNTFDTTRILTKRAGGNCSVACIGPAGEN
LVHIACIINEEHRAAGRTGVGAVMGSKKLKAIVVKGSERPEIAKPDEFKAASKEMLDKIK
QNPVTGEGLPKYGTAVLVNVINNAGALPYKNWQEAYNEKADEISGETLEAKYLRKRVACW
GCSIGCGRATEVKTGPFKVLNTEGPEYESIWALGNDTAVINLEAVIKANHFCDELGIDTI
SMGSTIACAMELYEKGYIKDEDLQGLDLSFGSDAAMVEAVWRTAYKTGIGKYLALGSKRL
AEIFGAPELSMSVKGLEMPAYDPRGIKGIGLNYATANRGGCHVTGYTVSPEIVGLPEKID
PLTYEGKAAWVKAFQDFTCVVNSAVNCLFTTFALGAEDYAVLLSHITGWDLNADEIMKIG
ERIYNLERVILNKYGFDGKDDTLPKRLLTEPLKEGPAKGQVVELDRMKEEYYQLRGWENG
VPTKEKLKELDIP
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaggttatatgggcaaaattttgaaggtgaatttgagcgaggggagcataaag
gagctcccgattgatgaggaaatagccagaaaataccttggcgggaagggatatgcagta
agacttctttacgactacctcaccgagtacgagaggctcggaatcgccccagaggacatc
gacccgctcggggaggagaacgttctgattttcgctactggccctgcgacgggtgttata
ggctttccagaaccgggaaggtaccacgtcatgactctcagaagcccgctaaccggaggg
attggctccgcaaacagcggtggcagatttggaccgtacatgaagtttgcgggctacgac
atgattattgtggagggcaaaagcgaggagcccgtttacctcgaggtaattgatggttct
gcagagataaagtgcgcaaaggacctttggggcaaaaacaccttcgacaccacgagaatt
ctcacaaagagagctggaggaaactgcagcgtcgcatgcatcggtcccgcgggagagaat
ctagtccatattgcctgcataataaacgaagagcacagagctgcagggagaacgggagtt
ggagccgttatgggctcgaagaagctaaaggcgatcgtcgtcaaaggctcggagaggccg
gaaatagccaagcccgacgagttcaaggctgcatcaaaggaaatgctggacaagatcaag
cagaacccggtaacgggagagggtctgccgaagtacggaacagcggtgctggttaacgtg
ataaacaacgccggagcgttgccctacaagaactggcaggaggcgtacaacgagaaggcg
gatgaaatcagcggagaaacactggaggcgaagtacctgaggaagagggtcgcatgctgg
ggctgcagcatagggtgcggaagggcgacggaggttaagaccggtccgttcaaggtcctc
aacactgaagggcctgagtacgagtcaatttgggctctcggtaacgatactgcagtgata
aaccttgaggcggttatcaaggccaaccacttctgcgacgagcttggcatagacacaatc
tcaatgggttcaacaattgcctgtgcgatggagctttacgagaagggctacataaaggac
gaggaccttcagggactcgatttgtccttcggcagcgatgcggcgatggttgaggctgtg
tggagaactgcgtacaagactggtatagggaagtacctggctttgggcagcaaaaggttg
gcagagatcttcggcgcacctgagctttcgatgagcgttaagggacttgagatgcctgcc
tacgacccaagaggcataaagggcataggactgaactacgcaaccgcaaacagaggaggt
tgccacgttaccggctacacggtctcgccggaaattgtggggctgcctgagaaaatcgac
ccactcacctacgaaggaaaggccgcatgggttaaggccttccaggacttcacctgtgtg
gtgaactccgcggtgaactgcctcttcacgaccttcgctctcggtgcagaggactatgcg
gtgctgctctcccacatcacaggatgggatttgaacgctgacgagataatgaaaattgga
gagagaatttacaacctcgagagagttatactcaacaagtacggcttcgacggcaaggat
gacacacttccgaagcgcttgctaaccgaaccgcttaaggaggggccagccaagggacag
gtcgttgagctggacaggatgaaggaggagtactatcagctaagaggctgggagaacgga
gttccgacaaaagagaaattgaaggagctggacatcccctaa

DBGET integrated database retrieval system