KEGG   Archaeoglobus fulgidus DSM 4304: AF2322Help
Entry
AF2322            CDS       T00011                                 

Gene name
pcm-2
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Brite
Enzymes [BR:afu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AF2322 (pcm-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2076924..2077583
Genome map
AA seq 219 aa AA seqDB search
MDYDEKRERLAERLRQELNLSRKVYEAIRKVPRHLFVPESYKNEAYVDTPLPIGYGQTIS
APHMVAIMCELLDLREGDKVLEVGTGCGYHAAVTAEIVGKSGKVISIEYIPELAERARAI
LKALGYDNVEVIVGDGSKGYEKEAPYDKIYVTAAAPDIPKPLIEQLKPRGRMVIPVGDSV
QWLIIVEKDESGNVRKKNWGSVRFVPLRGEYGFKSVRYD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggactacgatgagaaaagagagaggctggcagagagattgaggcaggagcttaacctg
agcaggaaagtttacgaggcgataagaaaggtgcccagacacctttttgtgcccgagagc
tacaaaaatgaagcttacgttgacacacccctcccaataggctacggccagacgataagc
gcaccccacatggtcgcgatcatgtgcgagcttctcgatttgagggagggggataaggtc
ctcgaggtgggcacgggttgcggatatcacgccgctgtgactgcagaaattgtcgggaag
agcgggaaggtgatatccatcgagtacattcctgaactggcggagagggctagggcgatt
ctgaaggcgcttgggtacgacaatgttgaggtgatagtcggcgacgggagcaagggctac
gagaaagaggctccttacgacaaaatctacgtcaccgctgcggcgcctgacatccccaag
ccgctgatagagcagctaaagcccagaggcaggatggtcattcctgtaggtgactccgtg
cagtggctgataatcgtggaaaaggatgagagcggcaatgtaaggaagaagaactggggt
tctgtgcgatttgtgcccctaaggggcgagtacggcttcaaaagtgtgaggtatgattaa

DBGET integrated database retrieval system