KEGG   Archaeoglobus fulgidus DSM 4304: AF2389-NHelp
Entry
AF2389-N          CDS       T00011                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AF2389-N
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AF2389-N
   00620 Pyruvate metabolism
    AF2389-N
   00640 Propanoate metabolism
    AF2389-N
  Energy metabolism
   00680 Methane metabolism
    AF2389-N
Enzymes [BR:afu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AF2389-N
Lipid biosynthesis proteins [BR:afu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AF2389-N
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
Position
join(2131926..2132894,2132894..2133640)
Genome map
AA seq 571 aa AA seqDB search
MTMPGLESLLREERVFYPPKELAENSNIKQFMDKHGIKDEDELRKRALENPEWFWSEMAK
EVGIEWFSEPEKVLEWDPPYAKWFVGAMYNIVHDALDKQAELRKNKVAYIWEGENGDVRK
ITYGELYREVNKLANALKELGVKKGDRVAIYLPMIPELPIAMLACAKIGAIHTDVFSGFS
PMALRDRINDAEAKLLITADGFYRRGSVIHLKEDADKALEDAPSVEKVIVARRIGLDVPM
KEGRDYWWDDVTRNQPKECETEVMDANDILFILYTSGTTGKPKGVMHAHGGYAVGTAATL
KFVLDLKENDVYWCTADIGWITGDSYIVYAPLILGATSVIYCGVPDYPKPDRWWEIIEKY
GVTVFYTAPTAIRMFMRLGEEWVEKHDLSSLRILGSVGEPINPEAWYWYYKHIGKERCPI
MDTWWQTETGHFIVTPLPVTPLKPGSATKPFPGIEADVFDDSGNSLYGKNVGGYLVIKKP
WPGMLRGVWRNPERYFKTYWEKFKDVYLTGDAARVDEDGYFWIQGRLDDVLNVAGHRIGN
SEVESALVSHPAVSEAAVVGKPHEVKGEAIV
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgccaggacttgagtccttgctgagggaggagcgagttttctaccctcccaaa
gagctcgccgaaaactcgaacatcaagcagtttatggacaagcacggcataaaggatgag
gatgagctgagaaaaagggctttggagaacccggagtggttctggagtgagatggcgaag
gaagttggaatcgagtggttttccgagcccgaaaaagttcttgagtgggaccctccctac
gccaagtggtttgtgggggcgatgtacaacatagtccacgatgcccttgacaagcaggct
gagctgaggaagaacaaggttgcttacatatgggagggagagaacggggatgtgaggaag
ataacctacggcgagctttacagggaggttaacaagctcgcaaacgccctcaaggagtta
ggagttaagaagggcgacagggttgcgatttacctccccatgattcctgaactgccaata
gcgatgcttgcatgtgcgaaaatcggggcgattcacaccgacgttttctccggcttcagc
cctatggcgctgagagatagaatcaacgatgctgaagcgaagcttctgattacagccgac
ggtttttaccgcaggggaagtgttattcacctcaaggaggatgcggacaaggctttggag
gatgcgcccagtgtggagaaggtcatcgttgcgaggagaattggcttggacgtgccgatg
aaggagggcagggactactggtgggatgatgtaacaagaaatcagccaaaggagtgcgag
acggaggtaatggatgcgaacgacattctgttcatcctctacacctctggcacaactggc
aagcccaaaggtgtgatgcacgcccacggcggctatgctgttggaacggcagcaaccctt
aagttcgttttggatttgaaggaaaacgacgtttactggtgcacggcggatataggatgg
ataacgggggacagctacatagtctacgcccccctgattctcggtgcgacatcggtgatt
tactgcggcgtccctgactatccgaagccggacaggtggtgggaaatcatcgagaagtac
ggcgtcacggtattctacactgcaccaacagccataaggatgttcatgcgcctcggcgag
gagtgggtggagaagcacgatttaagcagcctgcgtatcctcggaagtgtgggagagcca
ataaaccctgaagcttggtactggtactacaagcacatcggcaaggagagatgcccgata
atggacacgtggtggcagaccgagacgggtcacttcattgtcaccccactccctgttact
cctctgaagcccggctcagcgacaaagccgtttccaggaatagaagcggacgttttcgat
gatagcggaaactccctctacggcaagaacgttggaggctaccttgtcataaagaagccg
tggccggggatgctgcggggtgtgtggagaaacccggagaggtacttcaagacttactgg
gagaagttcaaggatgtttaccttactggcgatgctgcaagggttgatgaggacggctac
ttctggattcagggaaggctggatgatgttttgaatgtggcagggcacagaataggcaac
agcgaggttgagtctgccttagtcagtcatcctgccgtcagcgaggctgctgttgttgga
aagccgcatgaggttaagggagaggctatagtttag

DBGET integrated database retrieval system