KEGG   Archaeoglobus fulgidus DSM 4304: AF2389-NHelp
Entry
AF2389-N          CDS       T00011                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
afu  Archaeoglobus fulgidus DSM 4304
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AF2389-N
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AF2389-N
   00620 Pyruvate metabolism
    AF2389-N
   00640 Propanoate metabolism
    AF2389-N
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AF2389-N
   00680 Methane metabolism
    AF2389-N
Enzymes [BR:afu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AF2389-N
Lipid biosynthesis proteins [BR:afu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AF2389-N
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
join(2131926..2132894,2132894..2133640)
Genome map
AA seq 571 aa AA seqDB search
MTMPGLESLLREERVFYPPKELAENSNIKQFMDKHGIKDEDELRKRALENPEWFWSEMAK
EVGIEWFSEPEKVLEWDPPYAKWFVGAMYNIVHDALDKQAELRKNKVAYIWEGENGDVRK
ITYGELYREVNKLANALKELGVKKGDRVAIYLPMIPELPIAMLACAKIGAIHTDVFSGFS
PMALRDRINDAEAKLLITADGFYRRGSVIHLKEDADKALEDAPSVEKVIVARRIGLDVPM
KEGRDYWWDDVTRNQPKECETEVMDANDILFILYTSGTTGKPKGVMHAHGGYAVGTAATL
KFVLDLKENDVYWCTADIGWITGDSYIVYAPLILGATSVIYCGVPDYPKPDRWWEIIEKY
GVTVFYTAPTAIRMFMRLGEEWVEKHDLSSLRILGSVGEPINPEAWYWYYKHIGKERCPI
MDTWWQTETGHFIVTPLPVTPLKPGSATKPFPGIEADVFDDSGNSLYGKNVGGYLVIKKP
WPGMLRGVWRNPERYFKTYWEKFKDVYLTGDAARVDEDGYFWIQGRLDDVLNVAGHRIGN
SEVESALVSHPAVSEAAVVGKPHEVKGEAIV
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgccaggacttgagtccttgctgagggaggagcgagttttctaccctcccaaa
gagctcgccgaaaactcgaacatcaagcagtttatggacaagcacggcataaaggatgag
gatgagctgagaaaaagggctttggagaacccggagtggttctggagtgagatggcgaag
gaagttggaatcgagtggttttccgagcccgaaaaagttcttgagtgggaccctccctac
gccaagtggtttgtgggggcgatgtacaacatagtccacgatgcccttgacaagcaggct
gagctgaggaagaacaaggttgcttacatatgggagggagagaacggggatgtgaggaag
ataacctacggcgagctttacagggaggttaacaagctcgcaaacgccctcaaggagtta
ggagttaagaagggcgacagggttgcgatttacctccccatgattcctgaactgccaata
gcgatgcttgcatgtgcgaaaatcggggcgattcacaccgacgttttctccggcttcagc
cctatggcgctgagagatagaatcaacgatgctgaagcgaagcttctgattacagccgac
ggtttttaccgcaggggaagtgttattcacctcaaggaggatgcggacaaggctttggag
gatgcgcccagtgtggagaaggtcatcgttgcgaggagaattggcttggacgtgccgatg
aaggagggcagggactactggtgggatgatgtaacaagaaatcagccaaaggagtgcgag
acggaggtaatggatgcgaacgacattctgttcatcctctacacctctggcacaactggc
aagcccaaaggtgtgatgcacgcccacggcggctatgctgttggaacggcagcaaccctt
aagttcgttttggatttgaaggaaaacgacgtttactggtgcacggcggatataggatgg
ataacgggggacagctacatagtctacgcccccctgattctcggtgcgacatcggtgatt
tactgcggcgtccctgactatccgaagccggacaggtggtgggaaatcatcgagaagtac
ggcgtcacggtattctacactgcaccaacagccataaggatgttcatgcgcctcggcgag
gagtgggtggagaagcacgatttaagcagcctgcgtatcctcggaagtgtgggagagcca
ataaaccctgaagcttggtactggtactacaagcacatcggcaaggagagatgcccgata
atggacacgtggtggcagaccgagacgggtcacttcattgtcaccccactccctgttact
cctctgaagcccggctcagcgacaaagccgtttccaggaatagaagcggacgttttcgat
gatagcggaaactccctctacggcaagaacgttggaggctaccttgtcataaagaagccg
tggccggggatgctgcggggtgtgtggagaaacccggagaggtacttcaagacttactgg
gagaagttcaaggatgtttaccttactggcgatgctgcaagggttgatgaggacggctac
ttctggattcagggaaggctggatgatgttttgaatgtggcagggcacagaataggcaac
agcgaggttgagtctgccttagtcagtcatcctgccgtcagcgaggctgctgttgttgga
aagccgcatgaggttaagggagaggctatagtttag

DBGET integrated database retrieval system