KEGG   Archaeoglobus fulgidus: AF2402Help
Entry
AF2402            CDS       T00011                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
afu  Archaeoglobus fulgidus
Brite
Enzymes [BR:afu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AF2402
Transfer RNA biogenesis [BR:afu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    AF2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2146053..2147606
Genome map
AA seq 517 aa AA seqDB search
MFELAKEIAENARSKEEVLRIKRLFARRHGLSTIPSDAEILRAAKGTELYGKLREILRVK
PVRTISGVAVVAVMTSPAPCPHGKCLPCPGGVEKNTPQSYVGLEPAAMRGRQHGYDAFKQ
VTARLRELESIGHDVSKVEIIVMGGTFPARDADYKEKFMLGIFNALNSFNSNTKPENDLE
RAKRKNERAKARCVGITFETRPDYAREEHIREMLRFGGTKVELGVQSLYDDVLERIKRGH
GVKEVAEATRLLRDSAFKVGYHIMPGLPGSSFERDLRMFRELFENDSFKPDYLKIYPTLV
VEGTELYEMWKRGEYEPYTTEEVVELIVMAKRRFPEWVRVQRIQRDIPVKAAIGLDKGNI
RQLVHRRLKEMGYSCRCIRCREVGHKGVRPEEYSKAELVVREYVASEGREFFISFEIPEY
DALVGFVRLRFPKEPFIEVLRDAALIRELHVYGRAVPIGQSSDAFQHRGFGERLLKEAEE
IAKEEYDRIAVISGVGVRDYYRKLGYRLRQGYMVKKL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgagcttgccaaagagattgccgagaatgcaagaagcaaggaggaagttctcagg
ataaagaggttattcgccagaaggcacggcctctccaccataccgtcggacgccgagata
ctcagggctgcgaaagggacggagctctacggaaaattgagggagattctgagagttaag
cccgtcagaaccatcagcggtgttgctgtggtggctgtaatgacgtctccagcaccctgt
ccccacggcaagtgccttccgtgccccggtggtgtggagaagaacacaccgcagagctac
gtcggccttgagcctgcggcgatgagggggaggcagcacggctacgatgcatttaagcag
gtcactgcaagacttagggagcttgagagcataggccacgacgttagcaaggttgagata
atcgtgatgggcggaacctttcccgcgagagacgctgattacaaggaaaaattcatgctg
ggtattttcaacgctctcaacagctttaacagcaacaccaaacccgaaaatgacctggaa
agggcgaagaggaagaatgagagggccaaggcgaggtgcgttgggataacattcgagacc
cggccggattatgcgagagaggagcacataagggagatgctgaggttcggcggtacaaag
gttgagctgggcgttcagagcctttacgatgacgtgctggagagaataaagaggggacac
ggggttaaggaagttgcggaggcaacgagactgctcagggactcagcctttaaggtcggc
taccacatcatgcccggacttccggggtcgagctttgaaagagacctgagaatgttcaga
gagcttttcgagaacgatagcttcaagccggattacctcaaaatttaccctactcttgtc
gttgaggggacggagctttacgagatgtggaagagaggggagtatgagccatacacaact
gaagaggtggtggagctaatcgtaatggcaaagcgtcgctttcccgagtgggtgagggtt
cagaggattcagcgcgacattcccgttaaggcggcaataggcttggacaagggcaacatc
aggcagcttgtccacagaaggctgaaggagatgggatacagctgcaggtgcattcgctgc
agggaggttggacacaaaggggtgaggcccgaggagtactccaaagccgagcttgttgta
agagagtacgttgcatccgaaggtagggagttcttcatatccttcgaaatacccgagtac
gatgcgcttgtcggctttgtgaggctgaggtttcccaaagagccttttatcgaggtgttg
agagatgctgctctaattagggagcttcacgtttacggcagggctgtgccgattgggcag
agcagcgacgccttccagcacagggggtttggtgagaggctgctgaaagaggctgaggag
attgcgaaggaagaatacgacagaattgcggtaatcagcggtgtgggtgtgagggattac
tacagaaaacttggctacaggctcagacaaggatacatggtcaagaaactgtag

DBGET integrated database retrieval system