KEGG   Aspergillus flavus: AFLA_001410Help
Entry
AFLA_001410       CDS       T01090                                 

Definition
(RefSeq) pectin methylesterase, putative
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
afv  Aspergillus flavus
Pathway
afv00040  Pentose and glucuronate interconversions
afv01100  Metabolic pathways
Module
afv_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AFLA_001410
Enzymes [BR:afv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AFLA_001410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase Pectate_lyase_3
Motif
Other DBs
NCBI-GeneID: 7921854
NCBI-ProteinID: XP_002382342
UniProt: B8NPS7
Position
Unknown
AA seq 324 aa AA seqDB search
MHGSLLKLALLSFSLASSAAVLPRDTGRTSAPSGCSTVGTSGDYSTIGDALTALGSSTAD
ACIYIAAGTYEEQLVINYAGHLTLYGETTDTQTYKQNTVTITHTISSPEAGSLDNSATVN
IKSDLVSVYNINIANGYGSGAQAVALVANADQLGFYACQFTGYQDTLYAKAGHQYYINSR
IEGAVDYIFGDASAWFENCDIVSNGAGYITAMSRETTSDTAWYAIDHCNIKAASGVDLTG
DVYLGRPWRVLARVIYQYSVLPDIINAKGWHSMADGATPLYYEFNNTGAGSDTSDREYLS
TIDAPVAKETVLGDDYKNWVDSSY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcacggttccctcctgaaacttgctctattgagcttcagtctcgctagttctgcagct
gtgctacccagggacacaggtcgaaccagtgcgccatctggatgttctacggtgggcacg
tctggcgattattcaaccatcggcgatgctctcactgctctaggctcatcgacggcggac
gcatgtatttacattgccgctggcacgtacgaggagcagctggttattaactatgcgggc
cacttgacattatacggagagacaacagatacacaaacctataagcagaataccgtcacc
atcactcataccatatcatctccggaggctggttccctcgataacagtgccactgtcaat
atcaagtcggacttggtttcggtgtacaatatcaatatagcgaatggatatgggtcaggc
gcgcaggccgttgccctcgtcgcaaatgccgaccaacttggcttttatgcatgccaattc
acagggtatcaggatactttgtatgccaaagccggccatcagtactatatcaattctcgg
attgaaggagctgtcgattatatctttggcgacgcatctgcctggtttgaaaattgcgat
atagtctcgaatggtgctggttacatcaccgccatgtcgcgtgagaccacttcggacact
gcttggtatgccattgaccactgcaacatcaaggcagcgtcgggagtggatctgactggc
gatgtatacctgggccgaccctggcgcgtcctcgcccgcgtgatctatcagtactcagtc
ctaccggacattattaacgccaaaggttggcattctatggcggatggtgcgacgcctctc
tattatgagttcaacaatactggtgctggatccgacacatcggaccgagagtatctaagt
accattgatgctcctgtggccaaggaaacagttttaggagacgactataaaaattgggtt
gattcaagctattag

DBGET integrated database retrieval system