KEGG   Aspergillus flavus: AFLA_004660Help
Entry
AFLA_004660       CDS       T01090                                 

Definition
glycogen synthase Gsy1, putative
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
afv  Aspergillus flavus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFLA_004660
Enzymes [BR:afv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AFLA_004660
Glycosyltransferases [BR:afv01003]
 Polysaccharide
  Storage polysaccharide
   AFLA_004660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 722 aa AA seqDB search
MASEETGAEPPKRDVRNHMLFEVATEVANRVGGIYSVLKSKAPVTTAEYGERYTLIGPLN
RASAAVEVEELTPSNPRMIETIKSMQERGIEVIYGRWLIEGAPRVLLIDTSTGYKFLDEW
KGDLWNTAGIPSPAADTETNEAIVFGYLVAWFLGEVRLIDCTIFIAHERRVAVVAHFHEW
LAGVALPLTKKRHMDLTTIFTTHATLLGRYLCAGSVDFYNHLQHFDVDAEAGKRGIYHRY
CIERAAAHTADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFSAVHEFQNLHSQSKE
KINDFVRGHFYGHNDFDLDNTLYLFTAGRYEFRNKGVDMFIESLARLNHRLKASGSKTTV
VAFIIMPAQTTSLTVEALKGQAVVKSLRDTIEMIEKGIGKRMYERCLAWKEGDNMPDEKD
LMASQDRVLLRRRLFAMKRHSLPPIVTHNMNNDHEDPILNQIRRVQLFNDPTDRVKIIFH
PEFLNSSNPVLPLDYDDFVRGTHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYM
EELIENSSDYGIYIVDRRMKGVDDSVNQLTDFMFNFALKSRRQRINQRNRTERLSDLLDW
KRMGLEYVKARQLALRRAYPSSFGSGEDFYDIIGGTEQKISRPLSVPGSPRDRSGMMTPG
DFASLQEVKEGLSTEDYIAWRLPGATDEDEPDDQYFPLTLRTKKTSDRPASPLDRISVNG
GN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgaggagactggcgccgaacctcccaagcgggatgttcgcaaccatatgctt
ttcgaagttgcgaccgaggtggctaatagggtgggtggaatttactccgtcctcaagtct
aaagctcccgtgacgaccgccgaatatggcgagcgatacactctgattggacccttgaac
cgtgcttcagcagcggtggaggtggaagaattgactccatctaatcctcgaatgatcgag
acgatcaagtcgatgcaagaacgtggcattgaggtcatctacggtcgctggctgattgaa
ggcgctccccgggtgcttttgatcgacacatcaacgggatataaattcctggacgagtgg
aaaggggacctgtggaacacggcggggatcccatcaccggctgcagacaccgaaaccaat
gaagcgattgtctttggatacctggtagcatggttcctgggtgaagtacgtttgatagac
tgtacgatcttcatcgcccatgaaagacgggttgcggtggtcgcccatttccacgagtgg
cttgctggggtagccctcccgctgaccaagaagcgacatatggatctcaccacaattttt
accacccacgcaactttactcggtcgctatctctgtgcgggatcagtggacttttataac
cacctacagcacttcgatgtggatgcagaggctggtaagcgtggcatctatcaccggtac
tgtattgagcgagccgcggcgcacacggcagacgtcttcactaccgtctcccatatcacc
gcgttcgaaagcgagcatctcctgaaacgaaagccagatggagttctgccgaatgggctc
aatgtcaagaagttctccgcagtgcatgagttccagaatctacactcacaatccaaagag
aaaattaatgacttcgttcggggccatttctatggccataacgatttcgatctggacaat
accctgtaccttttcacggcgggacgctatgaattccggaacaagggcgtcgatatgttc
atcgaaagcttggctcgcctgaaccatcgcttaaaagccagcggctccaaaactaccgta
gttgctttcatcatcatgccagcccagaccacgtctctcacggtcgaagccctcaaggga
caggctgtcgtcaagtccttacgggacacaatcgagatgatcgaaaagggcattggaaag
cgaatgtacgagcgttgccttgcgtggaaggaaggcgacaacatgccggatgagaaggac
ctcatggccagtcaagatcgcgtgctgttgcgacgcaggttgtttgccatgaagaggcac
tctttaccgccgatcgtcactcataacatgaacaatgaccacgaagacccaattttgaac
cagatccgccgtgttcagctgttcaacgatccaaccgaccgcgttaagataatctttcac
ccagagttcctcaactcgtcgaaccccgtgctaccactcgattacgatgactttgtccgc
ggtacgcatcttggagtcttcccatcatactacgagccttggggttacacacccgctgag
tgcactgtgatgggtgtccccagtatcaccaccaatctgtccggtttcggttgctatatg
gaggagttaatcgagaactcatccgactacggtatttatatagtggatcgccgaatgaag
ggtgttgacgattccgtcaaccagcttactgatttcatgttcaactttgctctgaagagc
cgccgccaacggatcaatcaacgtaaccgcactgagcggttgagcgatctgttggactgg
aaacgtatgggattagagtatgtcaaagcgcggcagctggctcttcggcgagcctacccg
tcttcctttggtagcggcgaagacttctatgatattattggaggaacagaacagaagatt
tcacgaccgttatctgtcccagggtcaccaagggatcgctcggggatgatgacccctggt
gattttgcatccctgcaagaagtcaaagaaggactgagtactgaggactatatcgcatgg
cggctgcctggtgcaaccgatgaggatgaaccagacgaccaatacttcccactgacacta
cgaacgaaaaagacatccgatcgacccgcatcgccgctcgaccgcatatcagtcaatggt
gggaactga

DBGET integrated database retrieval system