KEGG   Aspergillus flavus: AFLA_005640Help
Entry
AFLA_005640       CDS       T01090                                 

Definition
lysophospholipase, putative
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
afv  Aspergillus flavus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 578 aa AA seqDB search
MATIDDIIPEMIERQLEPQLPEARVLIIMTGGTICMRPSPSGFIPARGFQEQCLARVPTF
NDGSPSTMMDVVVDNTGQIKGHQSLRTPQTAYGRRVRYTVFEFEELLDSSSIDAKGWAEI
ARTVERNYTLFDAFVILHGTDSLAYTSSALSFMLQNLGKTVILTGSQAPMLELQNDATDN
LLGSLVVAGHFMIPEVCLYFNNRLFRGNRSSKVAASDFAAFDSPNCTPLAVTTSMRTNVN
WELVNRPKGIEHFSIQTHLDTTHVACLRIFPGIKPEMIDAVLRLDGLRGLVLETFGAGNA
PHGQDNALIKVLADAIKRGIVIVNVTQCLTGSVSPVYATGMSLSRAGVVAGLDLTTEAAL
TKLAYLLGLPDATPESVARDMSKSLRGELTEVSQPVFRHPDGALTERVQALTILGYAIAQ
GDLARVEEILKLENHYLLNDADYSGNTPMVRCPFFIHLPHFRYLSVNQKLQHLAATSPSL
SILRFLLMQGGSVHIRNRNNRTPLFLAANAGLSEHVMLLRKSGAHLHSDERTAAQLLARR
RPGVWGLAGIGPREVSDREMEEVGEERLAERVLAGSAP
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccatagacgatatcattcctgagatgattgaacgacagttagaacctcagctc
cctgaggcgagggtccttatcattatgaccggaggtaccatatgtatgcgaccgtcacca
tcagggtttataccggcgcgagggttccaagagcaatgcctggcccgggtgcctactttc
aatgatggttctccttcgaccatgatggatgttgttgtcgataacacaggccagatcaag
ggccatcagagtctacggacaccacagactgcatacggccgccgagtaagatatacggta
tttgagtttgaggagctgctggacagcagttctattgatgccaaaggctgggcagaaatt
gcacggaccgtcgagaggaactacacactttttgacgcattcgtcatccttcacggtaca
gatagtctagcatacactagctctgcactcagcttcatgctgcaaaatctggggaaaacc
gtaatcctcacgggatcccaggctccgatgttggagcttcagaatgacgcgacagataac
cttcttgggtccctggttgtggctggccacttcatgattcccgaagtgtgtctgtacttc
aacaaccgactattccgtggtaaccggtcgagcaaggttgcggcaagtgacttcgctgca
tttgattctccgaattgcacaccgttggctgtgaccacttccatgcgcactaacgtcaac
tgggagttggtgaatcggccaaagggcatcgagcatttcagcattcagacacatctagat
actacccatgtcgcctgtcttcgtatattccctggtatcaagccagaaatgattgatgcc
gtgttgagactagacggactccgtggtttagtgttagagacctttggagctggtaacgca
ccacacggtcaagataacgctttgattaaagtgcttgcggatgccatcaagcgagggatt
gtgattgttaacgttactcaatgtttgactggcagcgttagcccggtatatgccaccggt
atgagcttgtctcgggctggtgttgtcgcaggtctcgacttaactacggaagccgcccta
acaaaactggcgtatctccttggtctaccagacgcaaccccggagtccgtggcacgggac
atgtcgaaatcactccgaggagaattgacggaggtttcgcagcccgtattccgtcatcca
gacggcgctctcaccgagcgtgtccaggcacttaccattttgggctatgccatcgcccag
ggagatctcgcacgtgtcgaagagatcctgaagctggaaaatcactaccttttgaacgat
gccgattactccggcaatactccgatggtaagatgccctttcttcatccatctcccccac
tttcgttacctgtctgttaaccaaaagcttcagcatctggccgcgacatcgccatcactc
tccatcctgcgcttcctactgatgcagggtggttccgtccacattcggaatcgcaacaac
cgcacaccactgttcctggcggccaacgcaggcttatcggagcatgttatgttgttgcgc
aagtcgggcgcccatttgcactcggatgaacggactgcggcacaattgctcgcgcgacgc
agaccgggcgtctggggattggcggggattggaccgcgggaggtcagtgaccgtgagatg
gaagaagtaggagaggagcgactggcggagcgagtgttggccggatcggcaccgtga

DBGET integrated database retrieval system