KEGG   Aspergillus flavus: AFLA_005870Help
Entry
AFLA_005870       CDS       T01090                                 

Definition
GTP cyclohydrolase I, putative
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
afv  Aspergillus flavus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:afv00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 331 aa AA seqDB search
MSSGSPQGPKPKSAVPPRLLNGSSSLNSNMNSRGARERESLNSSIRSSFAPRIPAEFNLP
ETVAHSVDESTHVTNESNTDSGAVKPSLNDPPRDPRDDARALTPPSTASRPASPYTLYPP
IDFDGLSWPCPGTRARLESSPEETEERVQKLAGAVRTILECIGEDPEREGLRETPERYAK
AMLYFTKGYEENVRDLVNGAVFHEDHDELVIVKDIEVFSLCEHHMVPFMGKMHIGYIPNR
RVLGLSKLARLAEMFSRRLQVQERLTKQVALAISEVLKPLGVGVVMESSHLCMVMRGVQK
TSSTTTTSCMLGCMRSSAKTREEFLTLLHRR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagttctggatctcctcaaggcccgaagcctaagtccgctgttccacctcgtctgttg
aacgggagctcttcgctcaattccaacatgaactctcgtggtgctcgcgaaagggagagt
ctcaactcatctattcgctcctcattcgccccccgtatcccggcagagttcaatttgcca
gagacggtcgcacactctgtcgacgagtctacccatgtcactaacgaatcgaatactgac
tcaggcgcggtaaagccatctttgaatgacccgccccgtgatccaagagatgacgcccgg
gctttgaccccaccgtcgacagctagccgcccggcaagtccatacacgctatatcctcct
atcgattttgacggactgagctggccctgccccggcacaagggcgcggttggagtcttcg
cccgaggaaacggaggaacgagttcaaaaattggcaggtgcagtgagaaccattctggag
tgcattggagaggatccagaaagagaaggtttgcgggagaccccagagagatatgcgaaa
gccatgctctacttcaccaaaggctacgaggagaatgtcagggatctagtcaatggcgca
gtcttccacgaggaccacgatgagttagttattgtcaaggacatcgaggtcttctctcta
tgtgaacaccacatggttccctttatgggaaagatgcatatcggctatatccctaatcgc
cgtgttcttggtctttcgaaattggcgcgcctggcggaaatgttctctcggcggctacag
gtgcaggagcgccttacaaaacaagttgcgctcgccatatcggaggtcttgaagccatta
ggtgtcggtgtcgtcatggagtcctcgcacctctgtatggtgatgcgcggtgtgcaaaaa
acgagcagcaccaccacaacgagctgcatgttgggatgcatgcgatctagcgcaaagacc
agagaggaatttttgactcttttgcaccggagataa

DBGET integrated database retrieval system