KEGG   Aspergillus flavus: AFLA_008110Help
Entry
AFLA_008110       CDS       T01090                                 

Definition
extracellular endo-1,4-beta-xylanase, putative
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
afv  Aspergillus flavus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MVHLKALASGTLFASLASSAVISRQAAASINDAFVAHGKKYFGTCSDQALLQNSQNEAIV
RADFGQLTPENSMKWDALEPSQGSFSFAGADFLADYAKTNNKLVRGHTLVWHSQLPSWVQ
GITDKDTLTEVIKNHITTIMQRYKGQIYAWDVVNEIFDEDGTLRDSVFSQVLGEDFVRIA
FETAREADPNAKLYINDYNLDSADYAKTKGMVSYVKKWLDAGVPIDGIVSLLPPRDEGLT
SCTALTALASTGVSEVAVTELDIEGASSESYLEVVNACLDVSSCVGITVWGVSDKDSWRS
STSPLLFDSNYQAKDAYNAIIDAL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggtacaccttaaggcacttgccagtggcactctcttcgcctccctcgcttcgtctgcg
gttatcagtcgacaggcagccgccagcatcaatgatgcctttgtcgcccatggaaagaag
tacttcggtacctgttccgaccaggctctgctgcaaaacagtcagaatgaggccattgtc
cgggcggactttggccagctgactcccgagaatagcatgaagtgggatgctcttgagccg
agtcagggtagctttagcttcgctggagctgatttcttggctgattatgctaaaactaat
aataaacttgtgaggggtcatactttggtgtggcactcgcaactcccatcctgggtgcag
ggtatcaccgacaaggatactttgactgaggtaattaagaatcacatcactactatcatg
cagagatacaagggccagatctatgcttgggacgttgtcaacgagatcttcgatgaggac
ggcactcttcgtgacagtgtcttttcccaggtcctaggagaggactttgtccgcattgcc
tttgagaccgctcgtgaggcggatcccaacgctaagctatacattaacgattacaacttg
gattcggcagactacgccaagaccaagggaatggttagctatgtgaagaagtggttggat
gctggtgttcccattgacggcattgtctctctcctgccaccgcgagacgaagggctaacg
tcatgcacagctctgaccgcgctcgcctctaccggtgtttctgaagtcgccgtgaccgaa
cttgatatcgaaggagctagctccgagtcttatctcgaggtggtcaacgcctgtctcgac
gtcagctcctgcgtcggtatcactgtctggggtgtatccgacaaggactcgtggcgctcc
agcacctccccgttgctatttgatagcaattaccaggccaaggatgcgtataatgctatc
atcgatgctctgtaa

DBGET integrated database retrieval system