KEGG   Aspergillus flavus: AFLA_014600Help
Entry
AFLA_014600       CDS       T01090                                 

Definition
profilin Pfy1, putative
Orthology
K05759  
profilin
Organism
afv  Aspergillus flavus
Brite
Exosome [BR:afv04147]
 Exosomal proteins
  Proteins found in most exosomes
   AFLA_014600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 132 aa AA seqDB search
MSGHSAVWQGYVDSSLMGSGLFDKAAVLSYNLSGIEAKSSGFSISAEELQGLAAAFAQSN
VAMANGIKVGGEKFVAIKADDRSLYGKKGKEGIIVVKTPSCVLVAHHGENVQTTNASAAV
EKIADYIINPHQ
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggcactctgctgtttggcaaggatatgtcgattccagcttgatgggatctggc
ctatttgacaaggctgccgttctgagctacaacctttccggcatcgaggctaaatcttcc
ggcttctcgatcagcgctgaagagctccaaggcctcgctgccgccttcgctcaaagtaac
gtggcgatggccaatggtatcaaggtcggcggagagaagttcgtcgctatcaaggccgac
gaccgcagtctatacggaaagaagggcaaggaggggattatcgttgtgaagaccccgtcc
tgcgtcctggttgcccaccacggcgagaatgtccagaccaccaacgcctcagccgctgtc
gagaaaatcgctgactacatcatcaaccctcaccagtag

DBGET integrated database retrieval system