KEGG   Aspergillus flavus: AFLA_018170Help
Entry
AFLA_018170       CDS       T01090                                 

Definition
1-phosphatidylinositol-bisphosphate phosphodiesterase Plc1, putative
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
afv  Aspergillus flavus
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AFLA_018170
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    AFLA_018170
Enzymes [BR:afv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     AFLA_018170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1145 aa AA seqDB search
MAYAATSSASTVNGDARSSLKLTASSSNPPKLHHVITSIPPAPNPSSAPSYTSSLTTTPN
SLRPAYFPSNASSPSGTPLQIATDGLRGRIPPFPAIPSTTFELGESVMAVPGNAPASGSG
DAVISNSKGPGLMRRISRGAANKLTRRRQSASHNEKRDRSSGPVTMRRRSDSKTGSQNGR
DNALESSNEEDSNDALDSLGVWCGSESSSLPNESFMAASRHTGTIAPKIDSAIQRGTVLT
KVTKKRRKQVRFFLDLDAGKVYWDVSNPAKRFYIDDIKEIRVGVDARNYREEHQIPQDTE
NRWFTIVIADDERSKGRTVKTLHLIAPNTPILELWTTTLEHISRYRIGLMAGLAGSGQSE
AVLKAHWQREMSRLFPHGTRSAEQGSLDFGAVESICRSLHINCSKNMLRAQFSKADSDVN
GKLNFSQFQNFVARLKERKDVKEIFKDSATDAKAGLSVDEFLKFLRNIQNENVDSDRSYW
VSVFDKCVRKSKSRVPSIPEFEEEQVPRMDLDAFSSFLASPWNGLYASRAPQSRFDRPLN
EYFISSSHNTYLLGRQVAGASSTEAYISALQKGCRCVEIDCWDGADGRPIVSHGRTMTTS
VLFADCITVINRYAFITTDFPLILSLEVHCNPEQQLAMVKIMKDTFKDQLVLEPLLTNSF
VLPSPEELKGRILVKVKTCDELQEGVRQEPVGTFAVHGRKRSASSPFIRPTASESSAITS
LPPLSSPPTLGLETVGSFLTQDRRSFTTTSISSAAEESDGALATIRKEKKRRQKSKITKP
LSDLGVYTRGYKWHSFSSAESQRYNHVYSFAERSFEGICRDAENKALFEKHNRKYLTRVY
PSGFRLRSSNFDPLKFWRRGVQMAALNWQTYDIGMQMNQAMFAAGSDRTGYVLKPESLRA
LCPADEEKTKATEWKLVRFSVDVISAQQLPRPRSIGPDDKINPYVEIEMFSADDRGQSFV
YGEGGMNASARNGMSGIGFPHRRRTKIEQSNGYSPIFNDRFRLSLETKYPDLVFVRWTIW
SSQDGRSAGSNSSVQLATFTAKLSSLSQGYRYLPLYDGGGDQYLFSTLFCKITKEDPVSV
QRLDAEELRAERMGILRQIGQTVFKRTSSTERERGNDMATSAEDKDSSPDLTPTVSAAST
SSLPP
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgccgctacctcgtcggcttcgaccgtcaatggcgatgcccgctctagctta
aagctcactgcttcatcctccaaccccccaaagctacatcatgtcatcacatctatccct
cctgcccccaatccttcatcagcaccatcgtatacctcttctctaactaccactcccaat
tctttacgccccgcctattttccttcaaatgcttcaagcccctcaggcacgcctttacag
attgctaccgacggtctccgaggacgtatacctcccttccctgctatcccttctaccacg
ttcgagctcggggagtccgtgatggccgtcccaggaaatgctcctgcctctggatcgggg
gatgcagtcatctcgaattccaaaggtccgggcttgatgcgcagaatttcccgtggcgcc
gcaaacaagcttactcgaagacgtcaatctgcttcccacaatgaaaagcgcgaccgcagc
tccggccccgtgactatgcggagacgcagtgacagcaagaccggatctcagaacggccgc
gacaacgcactcgaatctagtaacgaggaagacagcaacgatgctcttgactccctcggt
gtttggtgcggatcagagtcatccagtttaccaaatgaaagtttcatggcagcctcccgc
cacaccggcacaatcgcgccaaagattgattcggcgattcagcgtgggactgtcttgacg
aaagttacaaagaagcgcagaaagcaagtccgtttcttcctagacctagatgcgggcaag
gtctactgggatgtctcaaatccggctaaacgcttttacattgacgatatcaaggaaatt
cgggttggcgtggacgcacggaattaccgcgaggagcaccagattccacaagacaccgaa
aatcgctggttcacaattgttatcgccgatgacgagcggtccaaaggtcgcactgtcaaa
acgctgcaccttattgccccaaatactcctatcctggagctttggaccacgactctagaa
catatctcccgatacaggataggtcttatggctggcctggctggttccggtcagagtgag
gcagtcctgaaggcgcattggcagcgtgagatgtcgagattgttccctcatggaaccagg
tcggctgagcaggggagtcttgattttggagccgtggagagcatttgtcgcagtctacat
atcaattgctccaagaacatgcttcgcgctcaattttccaaagctgattctgatgtcaac
ggcaagttgaacttctcacaatttcagaattttgttgctcgcttgaaagagcggaaagac
gtaaaggagatcttcaaggatagcgccacggatgccaaagctggcctgagcgttgatgaa
ttcttgaaattcctgcgaaacatccagaatgagaacgttgactctgatcgaagttattgg
gtctcggttttcgacaagtgtgtacgcaagtctaaatcgcgggtcccaagcatcccggag
tttgaggaggagcaagtccctcgaatggatcttgatgcattttcctctttccttgcgtct
ccatggaacgggttatacgcctcacgtgctccccaatcgcgattcgaccgtcccttgaac
gaatacttcatctcgagttcccacaatacctatcttttaggccgccaggtcgcgggagcg
tccagcacagaggcatacataagtgctttgcaaaaaggatgccgttgtgtagagatcgac
tgttgggatggggctgatggccgaccaattgtgtcccatggaagaactatgaccacgagc
gttctgtttgccgactgtatcaccgtcatcaatcgctatgcattcataactacagatttt
cctctcattttgtctctcgaggtacattgtaacccggagcagcaactggcaatggtcaaa
atcatgaaggataccttcaaagatcagctcgtcctggagccgctattaacaaatagtttt
gtccttccctcgcccgaagagctgaagggacgcattcttgtcaaggtaaagacctgtgac
gagctccaagagggtgtacgacaggaacccgtcggcacattcgccgttcacggccgtaaa
cgcagcgcaagctctcccttcatacggccgacggcatctgaaagctcagcaatcaccagt
ctgcctcctctgtctagccctccgacgcttggactggaaaccgttggctcatttttgacc
caagatagacgctcgttcacaaccaccagtattagcagtgccgcggaggaaagtgatggc
gcattggcgacaatcaggaaagaaaagaaaaggcgccagaagagcaagatcactaaaccc
ctgtctgatctaggtgtctacacccgagggtacaagtggcacagcttctcgtccgctgaa
agtcaacggtataatcatgtctactccttcgccgaacgatcattcgagggtatctgccgt
gacgctgaaaacaaggctcttttcgaaaagcacaaccgaaaatatctgactcgggtctat
ccatccggcttccgcttgagatcttcgaacttcgatccccttaaattttggcgtcgcggt
gttcagatggcggccttgaactggcaaacatacgacataggcatgcagatgaaccaggcc
atgtttgctgctgggagcgatcgaactggttacgtgcttaaacccgagtctcttcgcgcc
ttgtgcccagccgacgaagagaaaacgaaggctacagagtggaagcttgttcgattctca
gtggacgttatctctgcccaacaacttcctcgccctcgcagcattggccccgatgataaa
atcaacccttacgtggagattgaaatgtttagtgctgacgatcgtggtcagagcttcgtt
tatggtgagggtggtatgaacgcatccgcccgtaatggcatgtcgggcattggatttccg
caccgtcggcgcacgaagatcgagcagagcaatggatatagcccaatctttaatgatcgc
tttaggttgtcgttggagactaaatatcctgatttggtattcgttcgctggactatctgg
agctcacaggatgggcgcagtgcaggaagtaatagcagtgtccaacttgccacgttcact
gcaaagcttagcagcttatcccaaggataccgctacttgcccctgtatgatggcggcgga
gaccaatatctgttctcaaccttattctgcaagatcaccaaagaagacccggtgtctgtt
cagcggcttgacgcagaagaactgcgagctgagcggatgggtattcttcgacaaattggc
cagactgtctttaagcgcacgtcgtctacggagcgcgagaggggtaatgacatggcaacg
agcgcagaggataaggacagctctccagatctgacaccaacggtttctgcagcgtccact
tcatcgttgcctccttaa

DBGET integrated database retrieval system