KEGG   Aspergillus flavus: AFLA_018380Help
Entry
AFLA_018380       CDS       T01090                                 

Definition
anthranilate synthase multifunctional protein TrpC, putative
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
afv  Aspergillus flavus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afv01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:afv00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1043 aa AA seqDB search
MSQTPRLHNSLLSPSKRSSSWRAPISLTIPPHHPTKAARLDSASNVILIDNYDSFTWNVY
QYLVLEGATVQVFRNDELSLDELIAKKPTQLVVSPGPGHPTTDAGISNAAIQYFSGKVPV
FGVCMGQQCIISSFGGKVDVTGEILHGKTSVIKHDGKGAYEGLPTSLAVTRYHSLAGTHS
TIPDCLEVTSYAQLGEDSSKTVIMGVRHKELAVEGVQFHPESILTEYGRGMFRNFLKLTA
GTWEGNGKQSSAQSGTSVATGLAASNSTPKVDKKTSILEKIYDHRRAAVAIQKTIPSQRP
ADLQAAYDLNIAPPQVSFPARLRQSPYPLSLMAEIKRASPSKGMIAENACAPAQAREYAK
AGASVISVLTEPEWFKGSIDDLRAVRQSLEGVTNRPAILRKEFVFDEYQILEARLAGADT
ILLIVKMLSVELLTRLYHYSRSLGMEPLVEVNTPEEMKIAVQLGAEVIGVNNRDLTSFEV
DLGTTSRLMDQVNENTIVCALSGISGPKDVEAYKKEGVKAILVGEALMRASNTSAFVAEL
LGGSYEKSTQTSRASPLVKICGTRSEDGARAAIEAGADLVGIIQVQGRKRTVSDDVALRI
SQVVKSTKRPVTHTASTTQGTSNATSVDYFDHSTNVLRHPNRALLVGVFQNQPLSYILEQ
QQKLELDVVQLHGSEPLEWAKLIPVPVIRKFGLDETGIARRAYHTLPLLDSGAGGSGELL
DQSGVQTVLDSDAGLRVILAGGLDPTNVADTIKKLGSSGHKVVGVDVSSGVESDGVQDPN
LSLRTTLELSLLSNRRNILFIAIIPLLRVISFSTFTQPSWYVVVARPSGCLLESSSFQRS
TRTYTRTFNMGKSFAKVHLCSAGRLGDNGSKIPQWVQANGGTYSRQVTQDVTHLVTTKDA
YMNNIPAACLTYKATLVRQAITKRNEKFQLTFDKLQIYESSEEHVTYETECRYSRVGKSN
SQILAPAGSSLDTALVAFERFFEEYTGKSWALRGNGILPQPKRDSAGNLLPPHEGWYIYE
DNTNMFLDFIQKGSASTTDAFGK
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaactccccgcttacacaattcgttgctcagcccttcaaaaaggtcttcgtca
tggcgggctccgatctcgttgaccattcccccccaccatcccactaaagccgcacggctt
gacagcgcatccaatgtcattttgatcgacaactatgattctttcacctggaatgtctat
cagtatctggtcctcgagggcgccactgtccaggtgtttcgcaatgatgaattatccttg
gacgaattgatcgccaagaagccgactcaattggtcgtcagccctggtccgggccacccg
acaaccgacgctggaatcagtaatgctgcaattcaatacttcagcggtaaagtacctgtt
tttggtgtgtgtatgggtcagcaatgcatcatctcttccttcggtggcaaagtcgatgtc
acaggcgagatcttgcatggtaagacatcggtgataaaacatgacggtaagggtgcatat
gaagggctgccgacctccctcgccgtgactaggtatcattcccttgctggaacacactca
acgatccctgattgcctggaggtaacgtcttacgcccagctgggtgaggacagtagtaag
accgttatcatgggtgtgagacacaaggagcttgcagtggaaggtgtccagtttcatcct
gaaagtattctcacagagtacggccgagggatgtttaggaacttcctcaaacttacagcg
ggtacatgggagggtaacggcaaacaatccagtgcacagagtggcacttccgttgcaact
gggttagctgcctcgaatagcaccccaaaggtagacaagaagacttccatcttagagaag
atatatgatcaccgcagggctgccgttgccatccagaagactattccttcacaacggccc
gcggatcttcaggctgcttacgacctcaacattgctcctccacaagtctcattccctgcc
cgtctgagacaatcaccttatccgctgtctcttatggctgaaataaagcgcgcttcccct
tccaagggaatgattgcggagaacgcatgtgcccctgcccaggctagagagtacgctaag
gccggcgccagcgttatttctgtcctcactgagccagaatggttcaaaggtagcatcgac
gatttgcgtgccgttcgtcagagcttagaaggagttacaaacagacctgcaatcttaaga
aaggagtttgtttttgacgaatatcagattcttgaagcccgtcttgctggggctgatact
atcctgctcatcgtgaagatgctaagcgtcgagcttcttacaagattgtatcactattct
cgcagcttgggaatggagcctctcgtagaggttaatactccggaggaaatgaagatcgcg
gtgcagcttggagccgaggtgattggcgtgaacaacagagacttgacgagcttcgaggtt
gacctcggtaccacgagtcgtctcatggaccaggttaacgagaatactatcgtttgcgct
cttagtggaatttccggacccaaggatgtcgaggcttacaagaaggaaggtgtcaaagca
attctcgtgggagaggcacttatgcgggcatctaacacatctgcttttgttgcagagctg
ctcggggggtcttacgagaaatctactcaaacttcacgagcctcgccgttagtcaagatc
tgcggtacacgatcagaagatggggctcgggcggcaattgaggccggtgctgatttggtt
ggtattattcaggtacagggacgaaagcgtactgtttcagatgatgttgctcttcgcatt
tctcaagttgtgaagtccacgaagcgacctgtcactcataccgcttcgacgactcaagga
acatcaaatgcaacctcggttgattactttgatcattccactaatgtcctacgccatccc
aaccgagctctgctcgtgggtgtgttccagaatcagccattgtcgtacatcctagagcag
cagcaaaagctggaactcgatgtggtccaattacacggttctgagccattggagtgggct
aagttaataccggtgcctgtaatccgcaaattcggtcttgacgagactggaattgcacga
agagcctaccatactttgcccttacttgattctggagctggcggctcgggtgaattgctt
gatcagtccggtgttcaaaccgttctggacagcgatgctggcctgcgtgttatcctggct
ggaggattggatcccacaaacgttgctgacacaatcaagaagctagggagctctggtcac
aaggttgttggggtagatgtcagttctggtgtggagtcggatggcgttcaggatccgaat
ttaagcttgcgaactacgctcgaactctcacttctaagcaatcgcaggaacatactcttc
attgctatcatcccgctcttacgggttatctctttctctactttcactcagcctagctgg
tatgtagttgttgccagaccatctggttgccttcttgaatctagttctttccaacgatct
acacgcacctacactcggacattcaatatgggcaagtcttttgcaaaggtccacttatgc
tcagctgggaggcttggagataacggtagtaaaattccgcaatgggtacaagcaaacggc
ggaacgtactctagacaagtcacacaggatgtgacgcacctagttaccaccaaagacgcc
tatatgaacaacatccctgcagcctgtctaacatacaaagcaacgcttgtccgacaggca
atcacgaagcgtaatgagaaatttcagcttacgtttgacaaactccagatctacgaatcc
agcgaggaacatgttacttatgaaaccgaatgcagatacagccgtgttggtaaatcaaac
tcccagattcttgctccagccggaagcagcttagacacggccctagtagcatttgaacgg
ttcttcgaagaatacacgggaaagagctgggcgctgcgtgggaacggaattctgccccag
ccgaagagagatagtgcaggtaacctcttacctccccatgagggttggtatatctacgaa
gacaatacaaatatgttcctcgactttatccagaaaggctcggccagcaccaccgatgca
tttggaaagtaa

DBGET integrated database retrieval system