KEGG   Aspergillus flavus: AFLA_018450Help
Entry
AFLA_018450       CDS       T01090                                 

Definition
tyrosinase, putative
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
afv  Aspergillus flavus
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    AFLA_018450
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AFLA_018450
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     AFLA_018450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 387 aa AA seqDB search
MRSWVPFVAALAALSPATASPTSMDQWDVLAGKALGNQILYHYTNPEASSTCTPYTASAR
REWGALSKKERRDYIDAVLCLSSKPSKSDPSFAPGARSRYDDFVAVHINQTMFIHSTGNF
LTWHRYFTWAYEQALRNECGYTGSQPYWAWNKYADDPVNSPIFDGSEYSMSGDGAFVPHN
ATEAAPGIFLQPSNGGGCVKSGPFKNFTVNLGPLLPSLKIPGLVAQNGTGLNYNPRCLRR
DISKQAAQWTTTKNVVDLIVNETDIWDYETTMQGDFPRGFLGLHSGGHYTIGGDPGGDFF
ASPGDPAFFLHHAAIDRAFWTWQNLDPVKRTYVVNGPTVLPGIVESPPNATLDDVVDMSA
ALAPPKTIRELLDTTGGTGGPFCYIYL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagttgggttccattcgtcgcagctcttgctgccctatcaccagcaactgcatct
cccacttccatggatcaatgggatgtactcgctggaaaagccctgggaaatcaaatcctg
tatcactacacaaacccggaagccagcagcacctgtaccccttacaccgcgtcggctcgc
agagaatggggggctctatccaagaaagaacgacgagactacatcgatgccgttctctgt
ctatcctctaagccttcaaagtccgacccctccttcgctcctggggctcgttcccgctac
gatgacttcgtagctgtgcacatcaaccagacgatgttcatccattcaacgggcaacttc
ctaacctggcaccgctacttcacctgggcctacgaacaagccctacgaaacgaatgcggc
tacacaggctcccagccctactgggcctggaacaaatacgccgacgacccagtcaactcg
cccatcttcgacggctcagaatacagcatgtcaggagacggcgcattcgtcccccacaat
gccaccgaggcggcacccggaatcttcctccagccttcgaatggaggcggctgcgtcaaa
tccggtcccttcaagaacttcacagtgaacctcggccccctcctcccaagtctcaagatc
ccaggcctggtcgcccaaaacggcaccggcctgaactataacccaagatgtctccgcaga
gatatctccaagcaagccgcccaatggaccacaactaaaaacgtcgtggacctgatcgtc
aacgaaacagatatctgggattacgagacgacaatgcagggtgacttccctcgtggcttc
ctcggtctgcatagcggtggacattataccattggtggtgatcctggcggtgactttttt
gcctcccccggtgatcccgctttcttccttcaccatgccgcgattgaccgggcgttctgg
acttggcagaatctggaccctgtgaagcggacttatgttgttaatgggccgactgtgctt
cctggtattgtggagtcgccgcccaatgctacgttggatgatgttgtggatatgagtgct
gctttggcgccgccgaagactattagggagttgttggatactactggcgggactgggggg
cctttttgttatatttatctgtga

DBGET integrated database retrieval system