KEGG   Aspergillus flavus: AFLA_019760Help
Entry
AFLA_019760       CDS       T01090                                 

Definition
palmitoyl-protein thioesterase precursor
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
afv  Aspergillus flavus
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AFLA_019760
  Lipid metabolism
   00062 Fatty acid elongation
    AFLA_019760
Enzymes [BR:afv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     AFLA_019760
Lipid biosynthesis proteins [BR:afv01004]
 Fatty acid synthase
  Component type
   AFLA_019760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 327 aa AA seqDB search
MRTLALLAIPFLSSAIPLHQPKTTESAPLPLVIWHGLGDDFQREGLLSVASLAEKTNPGT
YVHLIHLSDTASGDRQATFLGNVSEQIDTVCAQLASDRILSTAPAINALGFSQGGQFLRG
YIERCNVPPVHNLVTFGSQHNGIAEFQECGWGDWICRGAEALLRAGRWSPFVQGRFVPAQ
YFRDPTELDEYLASSNFLADVNNEREEKNETYRENLGRLNKFAMYMFEEDQMVHPKESAW
FGELDGETGDVIGVRERDIYREDWIGLKKLDEEGRLVFRSVPGKHMQLSEEVLVNVFGEF
FGPVEVDVDVEGEGEVRGKALVKQIGY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccctcgcgcttctagctatccctttcctttcaagtgccatccccctccaccag
cctaaaaccaccgaatccgcaccccttccactggttatctggcatggcctcggcgacgac
ttccaacgcgaaggcctcctctccgtcgcctccctcgccgagaaaaccaacccaggaacc
tatgttcaccttatccatctctcagacactgcctccggtgatcgtcaagccaccttcctc
ggcaacgtcagtgagcaaatcgacaccgtctgcgcccaactcgcctccgaccgcatcctc
agcacagccccagcaatcaacgccctcggattctcccaaggcggccagttcctccgtggc
tacatcgaacgctgcaacgtgccgcccgtccacaaccttgtcaccttcggcagccagcat
aacggcattgccgaattccaagaatgcggctggggcgactggatctgccgcggtgccgag
gcgctcctccgggcaggacgttggtcgcccttcgtgcagggccggttcgttcctgcacag
tatttccgcgatccgaccgaactggacgagtacctggccagtagcaattttcttgccgat
gtgaataatgagcgtgaagagaagaatgagacataccgggagaatctggggcgcttgaat
aagtttgcgatgtatatgtttgaagaggatcagatggtgcatccgaaggaaagtgcgtgg
tttggggagctggatggggagacaggggatgttatcggcgtgagggagagggatatctat
agggaggattggattgggttaaagaagttggatgaggaggggagactggttttcaggtct
gttccggggaaacatatgcagttgagtgaagaggttttggttaatgtctttggggagttt
tttggtccggtggaggttgatgttgatgttgagggtgagggtgaggtgcggggaaaggct
ttggttaagcaaattgggtactga

DBGET integrated database retrieval system