KEGG   Aspergillus flavus: AFLA_020000Help
Entry
AFLA_020000       CDS       T01090                                 

Definition
pectinesterase precursor, putative
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
afv  Aspergillus flavus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AFLA_020000
   00500 Starch and sucrose metabolism
    AFLA_020000
Enzymes [BR:afv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AFLA_020000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 331 aa AA seqDB search
MVKSLLVSGLFAATALAASRMTAPAGAIVVAKSGGDYDTLSAAVNALSTTETATQTIFIE
EGTYDEQVYIPSLAGKLIIYGQTEDDTTYTGNLVNITHNIKLADVANDDETATVRNHSPN
SSIYNLNIINTCGQVCHQALAVSAYGNGQGYYGCQFTGYQDTLLAQSGNQVYAHNLIEGA
VDFIFGQHARAWFQDCDIRVLKGPSSGYITANGRSSETDTSYYVIHKSSVAAADGNDVPS
GTYYLGRPWSQYARVLFQETSMTDVINSAGWSVWSTTQANTENVTFAEYGNTGAGAEGTR
ASFSEKLSEPVAISTILGSDWAQWVDTSYIN
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaatcacttttggtgtctggtctctttgccgcaacggctctggccgcgagccgc
atgacagctcctgctggtgcgatcgtcgttgccaagtctgggggtgactatgatacgctt
agcgccgccgttaatgccctgagcactaccgagaccgcgacgcagactatcttcattgag
gagggtacctacgacgaacaggtgtacatcccgtcgttggctggaaagctgatcatctac
ggtcagacagaggatgacaccacctacacgggcaacctcgtcaacatcacccataacatt
aagttggctgacgtcgccaatgatgacgagactgcaaccgttcgtaaccactcccccaac
tcgtccatctacaacctcaacatcatcaacacctgcggccaagtctgccaccaggccttg
gccgtgagcgcctacggcaatggccagggatactacggatgccagttcaccgggtaccag
gatactcttcttgcccaaagcggaaaccaggtctacgcccacaatctcatcgagggtgcc
gttgacttcatcttcggccagcacgcccgtgcctggttccaagattgcgacatccgtgtc
ctgaagggccccagctccggctacatcaccgccaacggtcgctcctctgaaaccgacacg
tcctactacgtaattcacaaatcctccgtcgcagccgccgatggcaatgatgtcccgtct
ggtacctactatctcggtcgcccatggtcccagtacgcccgcgtcctcttccaggagacc
tccatgactgatgtaattaactctgctggctggtctgtatggtcgactacccaggctaac
actgagaatgttacctttgccgaatatggcaacactggtgctggagcagagggtacgcgt
gctagtttctctgagaagctgagtgagcccgttgctatctcgaccattttgggctcggat
tgggcacagtgggttgatactagctatatcaactaa

DBGET integrated database retrieval system