KEGG   Aspergillus flavus: AFLA_022140Help
Entry
AFLA_022140       CDS       T01090                                 

Definition
ubiquitin C-terminal hydrolase, putative
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AFLA_022140
Peptidases [BR:afv01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AFLA_022140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 411 aa AA seqDB search
MKEFRVIDAAHSEEQLRLRLKPNELEQYGDAFIPEFVYQVIRQLPRFRDMRRGHQQDAQE
FLGFLLEEMHEECARAAKDAPSTKTDGAASLSEEPSAADDESGDGWLEVGHKQKPAVTRS
SGHMSYESPIMRIFGGQIRSEFKVPGNKTSVTLEPYQPLQLDIGSPEINNIVDALKGLTK
PESIQGDFNSSRGPNVTATKQIFIENLPPVLILHLKRFQYDSVTRGTQKIWKKVGYPLDL
EIPREVLPPNRRNIMMAQGGLPKYRLIGVIYHHGKNASGGHYTVDVRRQDGREWIRLDDT
VIRRVRSEDVAEAGGEEDPKVLAAALEQHKRDTNTNIYEQIDDLDQSDNERGWSQVNGTG
SGNHTSKKSTSAVTNGAPATSKAPSGTRTPIGRYGSKDNKVAYLLFYERIA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtttcgtgttattgacgctgctcattctgaggaacagttgaggttaaggttg
aaacccaatgaacttgagcaatatggagatgcgtttatcccagaatttgtttatcaggtg
attcggcagttgccacgctttcgagacatgcgccgaggacatcaacaagatgctcaagag
ttcttgggcttccttttggaggaaatgcacgaagaatgtgctcgtgccgcaaaggatgcg
ccatcgacgaagactgatggtgcagcatctctgagcgaagagccatctgcagctgatgac
gagtctggtgatgggtggttagaggttggtcataagcagaaacctgcggttacaagatct
tctggtcacatgtcttatgaatcacctatcatgaggatattcggtgggcaaatccggtct
gaattcaaagtacctgggaacaagacttctgtaaccttggagccttaccaacccttacag
ttggatattggttcacctgagatcaataacattgtcgatgctctcaaggggctgacaaaa
ccggagagtattcaaggagatttcaactcctcgcgcggcccgaatgtcacagcaacgaaa
cagatcttcattgagaatctaccacccgttcttattcttcacctcaaacgcttccagtac
gatagcgttaccagagggacccaaaaaatctggaagaaagttggatatcctcttgacttg
gagatccctcgcgaagtattacctcctaacaggcgcaatatcatgatggcccagggtgga
ctgcccaagtaccgactcattggcgtcatctaccaccacggcaagaacgcaagtggtggc
cattatactgtcgatgtccgtcgccaagatggtcgtgaatggattcgccttgatgacact
gtcattcgccgtgtcagaagcgaggatgttgcggaagccggtggcgaagaagaccccaag
gtgcttgcggcagctcttgaacagcataagcgcgacaccaacacgaatatctatgagcaa
attgatgatttggaccagtctgataatgagagaggttggagtcaggtcaatggaacaggc
tccggtaatcacacaagcaaaaaatccacttcagcagttaccaatggagctccagcgacg
tctaaagcaccttccgggactaggactccaattggacgatacgggtccaaggacaataag
gttgcatacctgctgttctacgagcgcattgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system