KEGG   Aspergillus flavus: AFLA_022640Help
Entry
AFLA_022640       CDS       T01090                                 

Definition
protein O-mannosyl transferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
afv  Aspergillus flavus
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    AFLA_022640
Enzymes [BR:afv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     AFLA_022640
Glycosyltransferases [BR:afv01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   AFLA_022640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 741 aa AA seqDB search
MAEMDSASSTGVNLASDMRRRNVPHTEGLRRKPDGTEESKRKPQLKANPSVSILDNWEPL
IMPILLTAVAIFTRMYRIGRSNIVTWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGLSG
YLAGYNGSFEFKSGEKYPEEVNYTFMRVFNAAFGVVCVPLAYYTARELGFRRATIWLVSL
MVLLENSYATISRFILLDSMLLCFTFTTTLCWAKFHRLQYASFSIEWFVWLFLTGISIGC
VCSVKWVGFFCTALVGLYTIEDLWNKFGDLKISEVVFAKHLMARVVGLIIIPVLVYVFSF
YLHFLVLENSGPGDAQMSSLFQANLRGTEVGKDSPLEIALGSRVTLKNMGYGGGLLHSHI
QTYPEGSTQQQVTCYHHKDANNDWFIYPSRREPEYDPSAPLKFVGDGDVIRLIHGQTGRN
LHSHAISAPITKSHYEVSCYGNVTIGDDKDHWLVEVVDDVASKDRSKIRTLTTAFRLRHP
VLGCYLRAGNVNLPQWGFKQIETTCVKENKPSDVYTHWNVESHFNDRLPPGDPGSYKSPF
LKDFIHLNVAMMTSNNALVPDPDKQDDLASKFWQWPILNVGLRMCSWDDNTIKYYLLGNP
FVYWGSTFSLGIFGLLVIWYLVRWQRGYNELSQADINHIHYSGLYPVIGWILHYLPFIVM
GRVTYVHHYYPALYYAILTFGFCVDWLTQTMDVKSRWVIYSLLYAIIVGMFVHFRVLVFG
IEGSSQQWGHLDWLSGWRIAN
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatggactctgcatcaagtaccggggtcaatttagcttctgatatgcggcgc
cgaaatgtcccgcataccgaggggcttagaaggaagcctgatggcacggaggaaagcaag
cgcaagcctcagctcaaagctaatccatcagtttccattctggataattgggaacctctg
ataatgcccattctgttgacggctgtggctatctttactcgcatgtaccgaattggtcgc
tcgaatattgtgacttgggatgaagcgcactttggcaagttcggatcacattacttgaaa
cgcgagttctatttcgacgtacacccgccgctgggaaaaatgcttgtcggcttgtcggga
tatcttgccggttacaacgggtcgttcgaatttaaatctggtgaaaaatatccggaagaa
gtcaactatactttcatgcgcgtctttaacgctgcgttcggcgtcgtgtgcgtgccactc
gcttattataccgcacgagaacttggcttccgcagagctactatctggctcgtgagtttg
atggtactacttgaaaactcatacgcaacaatctcaaggtttatattactggattccatg
ctactctgtttcacgttcaccactaccctttgttgggcaaagtttcaccgactacagtat
gcgagtttctcgattgagtggtttgtctggctattcctgaccgggataagcattggttgt
gtgtgcagtgtgaagtgggtgggtttcttttgcacagcgcttgtaggcctctatacaatc
gaggatctttggaacaaatttggcgatctaaagatatcagaggtcgtctttgccaagcat
ctcatggctcgtgtggtggggctgatcattatacccgttttggtttatgtattttcgttc
tacctgcatttcttggttctggaaaatagtggaccgggcgatgcccaaatgagttcactt
ttccaggctaatctgagaggaaccgaggtcgggaaagatagccccctggaaattgctctc
ggctctagagtcacactgaagaacatgggctacggcggcggacttctccattcgcatatc
cagacgtaccccgaaggatccacccagcagcaggttacctgttatcaccacaaggacgcc
aacaacgactggttcatctatcccagccgccgcgagccagagtatgatccgagtgcgccc
ctaaagtttgtaggtgatggtgatgtcattcgtcttattcatggacagacaggccggaat
ttgcactctcatgctatttctgcaccaattaccaagtcacactacgaagtctcatgctac
ggcaatgtcactatcggcgatgataaagatcattggttggttgaggtggttgatgatgtt
gcatcgaaggatagaagtaaaatccgtacacttaccactgcgttccgcctgcgacatcct
gtcctgggttgttatttacgagcaggcaacgtcaatctcccccagtggggcttcaaacag
attgaaaccacatgcgtgaaggagaacaaaccgagcgatgtttacacacattggaatgtc
gagtctcatttcaatgaccggctcccacctggtgatccaggatcctacaagtcgcctttc
ttgaaagactttattcatttgaatgttgccatgatgacgtccaacaatgcgttggttcct
gacccagataaacaagatgatctcgcctcgaaattttggcagtggccaatacttaatgtt
gggctccggatgtgctcttgggatgacaatactattaaatactatctccttggcaaccca
ttcgtttactggggaagtacatttagccttggcatctttgggctcttggtaatttggtat
ctcgtgcgctggcagcgaggttacaatgagctttcccaggcagatatcaaccatatccat
tattctggcttgtacccagtcattggatggattctgcattatctgcctttcattgttatg
ggaagagtgacgtatgttcatcattactacccagcattatattacgccattcttaccttt
ggattttgcgttgactggctcacgcaaacgatggatgttaaatcccgctgggtgatctat
tctttactttacgctatcatagttggaatgttcgtgcatttccgcgtgcttgtgtttggc
attgaaggttcgagtcagcagtggggtcatttggactggctgagcggctggcgcatcgcc
aattga

DBGET integrated database retrieval system