KEGG   Aspergillus flavus: AFLA_024290Help
Entry
AFLA_024290       CDS       T01090                                 

Definition
(RefSeq) alcohol dehydrogenase, putative
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
afv  Aspergillus flavus
Pathway
afv00010  Glycolysis / Gluconeogenesis
afv00071  Fatty acid degradation
afv00350  Tyrosine metabolism
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
afv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_024290
  Lipid metabolism
   00071 Fatty acid degradation
    AFLA_024290
  Amino acid metabolism
   00350 Tyrosine metabolism
    AFLA_024290
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AFLA_024290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 7916861
NCBI-ProteinID: XP_002373940
UniProt: B8N0I6
Position
Unknown
AA seq 365 aa AA seqDB search
MSAEVSSHDYQIPSHCKAGVVVNEGPNFEVKVEMVPVPEPGPDDILIRLNITGICSSDLH
MMQGDLGTPPMSTFGVRSPGHEGAGVVVKVGANVKNFKLGDRAGIKPLLDTCGACDLCWG
DKETYCPTAIHAGLMAPGTYQQYIVSPARYASPIPDGIPDEIAAPIMCSASTIYRSLTES
GLKPGNWAVFPGGGGGVGIQGVQLAKAMGMRPVVVDAGESKRALALEMGAEVFVDFIETS
DPAAAVIKATDGVGAHGVFVTAPAAYRTALSYVGNRIGAVVMCIGLGPTGAMTIGGDPNA
FIFKNLTVKGTLVGSRKDTAAALDFARRGKLQQICEVYPIDRLPEAVEKLRKGQATGRMA
VDFNK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgaagtgtcatctcacgattaccaaattccctcccactgtaaggcaggcgtg
gtcgtcaatgaaggtccgaacttcgaggtcaaggtcgagatggtgccggtcccggagcca
ggtcccgatgacattctaatccggttgaacatcaccggtatctgctcctcagacctccat
atgatgcaaggcgacttgggaaccccaccgatgtcaacatttggcgttcgctctccgggt
cacgaaggtgccggggttgtggtgaaagtcggcgcaaatgtgaagaacttcaaactaggc
gatcgggcgggcatcaaaccactcctcgatacgtgcggcgcgtgcgatttgtgctgggga
gataaggagacgtattgccccaccgctatccacgctggcttgatggcacctgggacctat
caacaatatattgtctctcccgcccgatatgcatcacccatccctgacggcattcctgat
gagattgcagcccctattatgtgcagcgcatccactatctatcgctctctaacagaatcc
gggctgaagccgggaaactgggcagtctttcctggcggtggtggtggggtgggtattcag
ggcgtgcagctcgctaaggcaatgggtatgcgtccagttgtggtggacgcaggcgagtca
aagagagcattggctttggagatgggcgcagaagtcttcgtggatttcatcgaaacgtcc
gatcctgccgcagctgtgattaaggcaacagatggtgtaggggcgcatggagtattcgtc
acagctcctgcggcctatcgaacggcgttatcatacgtcggtaatcgcattggagcggtt
gtcatgtgtatcggattaggtcccactggcgcaatgactatcgggggagatcccaatgct
tttatcttcaagaacctgacggtcaaggggaccttggtgggtagtcggaaggatacagcg
gcggcattggactttgctcggcgggggaagctccaacaaatttgcgaagtttatccaatt
gaccgattgcctgaagcagtagagaaactgcgaaaaggacaggccacgggacgaatggcg
gttgacttcaacaagtaa

DBGET integrated database retrieval system