KEGG   Aspergillus flavus: AFLA_024480Help
Entry
AFLA_024480       CDS       T01090                                 

Definition
6-phosphofructokinase alpha subunit
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
afv  Aspergillus flavus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFLA_024480
   01230 Biosynthesis of amino acids
    AFLA_024480
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_024480
   00030 Pentose phosphate pathway
    AFLA_024480
   00051 Fructose and mannose metabolism
    AFLA_024480
   00052 Galactose metabolism
    AFLA_024480
  Energy metabolism
   00680 Methane metabolism
    AFLA_024480
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AFLA_024480
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AFLA_024480
Protein phosphatases and associated proteins [BR:afv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AFLA_024480
Messenger RNA biogenesis [BR:afv03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AFLA_024480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 786 aa AA seqDB search
MMATTHAPAEPPKRRRIGVLTSGGDAPGMNGAVRAVVRMAIYSGCEAYAVYEGYEGLVHG
GDMIRQVHWEDVRGWLSRGGTLIGSARSMAFRERAGRLKAAKNMIVRGIDALVVCGGDGS
LTGADLFRSEWPGLLEELVKTGELTEEQIVPYKVLNIVGLVGSIDNDMSGTDATIGCYSS
LTRICDAVDDVFDTAYSHQRGFVIEVMGRHCGWLALMSAISTGADWLFIPEMPPREGWED
DMCDIITKNRQERGKRRTIVIVAEGAHDRQLNKITSSKIKDILTNRLDLDTRVTVLGHTQ
RGGAACAYDRTLSTLQGVEAVRAVLDMTPESPSPVITVRENKLLRTPLMDAVKATKEVAD
LIHERKFDEAMHLRDSEFKEYHFAYKNTATPDHPKLILPENKRMRIAIIHVGAPAGGMNQ
ATRAAVAYCQTRGHTALAVHNGFPGLCRHHADTPVSSVREVSWEEQDTWVNEGGSDIGTN
RSLPSEDFETTAKCFEKFKFDGLFVVGGFEAFTAVSQLRQAREKYPAFKIPMVVLPATIS
NNVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRVFVVETQGGKSGYVATTAGLAVGA
SAVYIPEEGIDIKMLARDIDFLRNNFAHDKGANRAGKIILRNETASSTYTTQVIADMIKE
EAKGRFESRAAVPGHFQQGGKPSPMDRIRALRMAIRCMQHIETFSGKSADEIAADELSAT
VIGVKGSQVLFSQMGGPNGLEATETDWARRRPKDEFWLDLQSTVNILSGRASFGEGKTGW
SCYENC
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgatggctacgacacacgcccccgcggagcctcccaagcgccgccgtatcggtgtcttg
acctctggtggtgatgctcccggtatgaacggcgccgtccgggctgtcgttcggatggct
atttattccggatgtgaagcctatgccgtatacgaaggctacgagggtctggtccatggc
ggagatatgatccgtcaggtacactgggaagatgtccgtggctggctctccaggggtggt
accttaatcggttcagctcgtagcatggctttccgggaacgtgccggtcgtctgaaggcc
gctaagaacatgattgtccggggtattgatgccctggtggtttgcggtggtgatggaagt
ttgactggtgccgacctcttccgttctgaatggcctggcttgctggaagagctggtcaag
acgggcgaattgactgaggaacagattgtcccttacaaggtgttgaacattgttggtctg
gtgggctcgattgataacgacatgtccggcacagacgctaccatcggctgttattcctcc
cttacccgcatctgtgatgcggtcgacgacgttttcgataccgcttattcgcaccagaga
ggcttcgttattgaagtcatgggacgccattgtggctggctggccttgatgtcggctatc
agcactggcgccgactggcttttcatccccgagatgccaccccgcgagggctgggaagat
gacatgtgcgatatcatcaccaagaaccgtcaggaacgaggcaagcggagaacgattgtc
attgtggccgagggcgctcatgaccgccaactcaacaagatcacgagcagcaagattaag
gacattttgaccaaccgacttgatctggacactagggtgaccgtcctaggccacactcaa
cgaggaggagcagcatgtgcctatgaccgtaccctctcgaccctacagggcgtggaagcc
gtccgtgccgttttggatatgacacccgaatctccgtcccctgtcatcaccgtccgcgag
aacaagttgctgcgcacgccgttgatggatgcagtgaaggccaccaaggaagtagccgac
ctcattcatgagcgcaagttcgatgaggctatgcatctgcgcgactctgaattcaaggag
taccatttcgcctacaagaacactgctacccccgaccaccccaagttgatcctcccagaa
aacaagcggatgcgcattgccattatacacgtcggtgcacctgccggaggtatgaaccaa
gccacccgtgctgccgtcgcctactgccagactcgtggacacacggcccttgccgttcac
aacggtttccccggcctctgccggcatcatgcagacacccccgttagctctgtgcgcgag
gtcagttgggaggagcaggacacctgggtcaacgaaggtggttcagacatcggaaccaac
cgaagcctgccgtccgaggacttcgagaccactgccaagtgttttgagaagtttaagttc
gatggtttgttcgtggttggtggtttcgaggctttcactgctgttagccaattgcgccag
gcccgcgagaaatatccagccttcaagatccccatggtggtcttgccggccaccatttca
aacaacgtcccgggtaccgaatactccctcggcagcgacacctgcttgaacactttgatc
gacttctgtgacgctatccgtcaatccgcgtcgtcctcccgccgccgtgtcttcgtcgtc
gaaacccagggtggtaagtccggttacgtcgctacgaccgctggtctcgcggtaggtgcc
tcggccgtctacatcccggaggaaggcatcgatatcaagatgctggcacgcgatatcgat
ttcctgcgcaacaacttcgctcacgacaagggtgccaaccgtgccggaaagatcatcctg
cgcaacgagaccgcttccagcacctacaccacacaagtcattgccgacatgatcaaggaa
gaagccaagggccgctttgagtcgcgtgcggcggtccctggtcacttccaacagggtggc
aagccctctccgatggaccgaatccgtgccctgcgcatggccatccgatgcatgcagcac
atcgaaaccttctccggcaagtccgccgacgagattgccgccgacgagctttctgcgacc
gtcatcggtgtcaagggatcccaggtactcttctcccagatgggcggtcccaacggcctg
gaagcgaccgagaccgactgggcccgtcgtcgcccgaaggacgaattctggcttgacttg
cagagcaccgtcaacattttgtccggtcgcgccagcttcggcgagggcaagacgggctgg
tcttgctacgaaaactgttaa

DBGET integrated database retrieval system