KEGG   Aspergillus flavus: AFLA_024480Help
Entry
AFLA_024480       CDS       T01090                                 

Definition
6-phosphofructokinase alpha subunit
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
afv  Aspergillus flavus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFLA_024480
   01230 Biosynthesis of amino acids
    AFLA_024480
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFLA_024480
   00030 Pentose phosphate pathway
    AFLA_024480
   00051 Fructose and mannose metabolism
    AFLA_024480
   00052 Galactose metabolism
    AFLA_024480
  Energy metabolism
   00680 Methane metabolism
    AFLA_024480
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AFLA_024480
Protein phosphatases and associated proteins [BR:afv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AFLA_024480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 786 aa AA seqDB search
MMATTHAPAEPPKRRRIGVLTSGGDAPGMNGAVRAVVRMAIYSGCEAYAVYEGYEGLVHG
GDMIRQVHWEDVRGWLSRGGTLIGSARSMAFRERAGRLKAAKNMIVRGIDALVVCGGDGS
LTGADLFRSEWPGLLEELVKTGELTEEQIVPYKVLNIVGLVGSIDNDMSGTDATIGCYSS
LTRICDAVDDVFDTAYSHQRGFVIEVMGRHCGWLALMSAISTGADWLFIPEMPPREGWED
DMCDIITKNRQERGKRRTIVIVAEGAHDRQLNKITSSKIKDILTNRLDLDTRVTVLGHTQ
RGGAACAYDRTLSTLQGVEAVRAVLDMTPESPSPVITVRENKLLRTPLMDAVKATKEVAD
LIHERKFDEAMHLRDSEFKEYHFAYKNTATPDHPKLILPENKRMRIAIIHVGAPAGGMNQ
ATRAAVAYCQTRGHTALAVHNGFPGLCRHHADTPVSSVREVSWEEQDTWVNEGGSDIGTN
RSLPSEDFETTAKCFEKFKFDGLFVVGGFEAFTAVSQLRQAREKYPAFKIPMVVLPATIS
NNVPGTEYSLGSDTCLNTLIDFCDAIRQSASSSRRRVFVVETQGGKSGYVATTAGLAVGA
SAVYIPEEGIDIKMLARDIDFLRNNFAHDKGANRAGKIILRNETASSTYTTQVIADMIKE
EAKGRFESRAAVPGHFQQGGKPSPMDRIRALRMAIRCMQHIETFSGKSADEIAADELSAT
VIGVKGSQVLFSQMGGPNGLEATETDWARRRPKDEFWLDLQSTVNILSGRASFGEGKTGW
SCYENC
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgatggctacgacacacgcccccgcggagcctcccaagcgccgccgtatcggtgtcttg
acctctggtggtgatgctcccggtatgaacggcgccgtccgggctgtcgttcggatggct
atttattccggatgtgaagcctatgccgtatacgaaggctacgagggtctggtccatggc
ggagatatgatccgtcaggtacactgggaagatgtccgtggctggctctccaggggtggt
accttaatcggttcagctcgtagcatggctttccgggaacgtgccggtcgtctgaaggcc
gctaagaacatgattgtccggggtattgatgccctggtggtttgcggtggtgatggaagt
ttgactggtgccgacctcttccgttctgaatggcctggcttgctggaagagctggtcaag
acgggcgaattgactgaggaacagattgtcccttacaaggtgttgaacattgttggtctg
gtgggctcgattgataacgacatgtccggcacagacgctaccatcggctgttattcctcc
cttacccgcatctgtgatgcggtcgacgacgttttcgataccgcttattcgcaccagaga
ggcttcgttattgaagtcatgggacgccattgtggctggctggccttgatgtcggctatc
agcactggcgccgactggcttttcatccccgagatgccaccccgcgagggctgggaagat
gacatgtgcgatatcatcaccaagaaccgtcaggaacgaggcaagcggagaacgattgtc
attgtggccgagggcgctcatgaccgccaactcaacaagatcacgagcagcaagattaag
gacattttgaccaaccgacttgatctggacactagggtgaccgtcctaggccacactcaa
cgaggaggagcagcatgtgcctatgaccgtaccctctcgaccctacagggcgtggaagcc
gtccgtgccgttttggatatgacacccgaatctccgtcccctgtcatcaccgtccgcgag
aacaagttgctgcgcacgccgttgatggatgcagtgaaggccaccaaggaagtagccgac
ctcattcatgagcgcaagttcgatgaggctatgcatctgcgcgactctgaattcaaggag
taccatttcgcctacaagaacactgctacccccgaccaccccaagttgatcctcccagaa
aacaagcggatgcgcattgccattatacacgtcggtgcacctgccggaggtatgaaccaa
gccacccgtgctgccgtcgcctactgccagactcgtggacacacggcccttgccgttcac
aacggtttccccggcctctgccggcatcatgcagacacccccgttagctctgtgcgcgag
gtcagttgggaggagcaggacacctgggtcaacgaaggtggttcagacatcggaaccaac
cgaagcctgccgtccgaggacttcgagaccactgccaagtgttttgagaagtttaagttc
gatggtttgttcgtggttggtggtttcgaggctttcactgctgttagccaattgcgccag
gcccgcgagaaatatccagccttcaagatccccatggtggtcttgccggccaccatttca
aacaacgtcccgggtaccgaatactccctcggcagcgacacctgcttgaacactttgatc
gacttctgtgacgctatccgtcaatccgcgtcgtcctcccgccgccgtgtcttcgtcgtc
gaaacccagggtggtaagtccggttacgtcgctacgaccgctggtctcgcggtaggtgcc
tcggccgtctacatcccggaggaaggcatcgatatcaagatgctggcacgcgatatcgat
ttcctgcgcaacaacttcgctcacgacaagggtgccaaccgtgccggaaagatcatcctg
cgcaacgagaccgcttccagcacctacaccacacaagtcattgccgacatgatcaaggaa
gaagccaagggccgctttgagtcgcgtgcggcggtccctggtcacttccaacagggtggc
aagccctctccgatggaccgaatccgtgccctgcgcatggccatccgatgcatgcagcac
atcgaaaccttctccggcaagtccgccgacgagattgccgccgacgagctttctgcgacc
gtcatcggtgtcaagggatcccaggtactcttctcccagatgggcggtcccaacggcctg
gaagcgaccgagaccgactgggcccgtcgtcgcccgaaggacgaattctggcttgacttg
cagagcaccgtcaacattttgtccggtcgcgccagcttcggcgagggcaagacgggctgg
tcttgctacgaaaactgttaa

DBGET integrated database retrieval system