KEGG   Aspergillus flavus: AFLA_027070Help
Entry
AFLA_027070       CDS       T01090                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
afv  Aspergillus flavus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:afv01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:afv00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:afv00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:afv00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:afv00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 710 aa AA seqDB search
MLTFLSGTRNPLFPLNPLLKTVVSRRLSSSSSISLTRKRIMADGNVMPPKPSVVLEAHEV
DTFHVPKAFYEKHPTGTHLKDLDEYKKLYDESIRSPQTFWARMARELLSFDKDFQTTHTG
SLENGDSAWFVEGRLNAAYNCVDRHALKNPDKVAIIYEADEPNEGRTITYGELLREVSRV
AWVLKQQGVKKGDTVAIYLPMIPEAVVAFLACSRIGAIHSVVFAGFSSDSLRDRVIDAGS
KVVITTDEGKRGGKVIGTKRIVDEALKQCPDVTSVLVYKRTGTEVPWTQGRDVWWHEEVE
KYPNYFPPESVSSEDPLFLLYTSGSTGKPKGVMHTTAGYLLGAAMTGKYVFDIHDDDRFF
CGGDVGWITGHTYVVYAPLLLGCSTVVFESTPAYPNFSRYWDVIEKHQVTQFYVAPTALR
LLKRAGDEHIHHKMAHLRILGSVGEPIAAEVWKWYFEKVGKEEAHICDTYWQTETGSNVI
TPLGGITPTKPGSASLPFFGIEPAIIDPVSGEEISGNDVEGVLAFKQPWPSMARTVWGAH
KRYMDTYLNVYKGYYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTAEIEAALLEHHM
VAEAAVVGIADELTGQAVNAFVSLKEGNETNEQVRKDLVMQVRKSIGPFAAPKAVFVVDD
LPKTRSGKIMRRILRKILSGEEDSLGDTSTLSDPSVVDKIIETVHTARGK
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccttcctttccggaaccagaaaccctctctttcctcttaatcctcttcttaag
actgtcgtgtctcgacgtctctcgtctagctcaagcatctccctgacgcgcaaacgaatc
atggctgacggcaacgtgatgccccctaagccctctgtggtgctggaagcccacgaggtc
gatactttccatgtccccaaggctttctacgagaagcacccaactggcactcacttgaaa
gacctggatgaatataagaagctctatgacgaatcaattcgcagtcctcaaaccttctgg
gcccgcatggcccgtgaactcctttccttcgacaaagactttcaaactacccacactggt
tctctggagaacggcgacagtgcctggttcgtggaaggccgcttaaatgctgcctacaac
tgcgtggaccgtcatgctctcaagaaccccgacaaggttgcgatcatttacgaggctgat
gagccgaatgagggccgtactattacctacggggagctgcttcgtgaagtatctcgagtt
gcctgggtgcttaaacagcaaggtgtcaagaaaggtgatactgtagctatctatcttcct
atgattccggaggccgttgtagccttcttggcctgttcccgcattggtgccatccactcc
gtggtgtttgcaggattctcgtcagactcgctccgtgaccgtgttatcgacgccggatct
aaagtggtcatcaccaccgacgagggcaagcgtggcggcaaggtgattggcaccaagcgt
attgttgacgaggctttgaagcagtgccccgacgttacaagcgtgttggtctacaagcgc
accggtactgaggtcccctggacccaaggtcgtgatgtctggtggcacgaggaggtggag
aagtaccccaattacttccctcccgagtccgtgagctccgaagaccccctgttcctgctt
tacacttctggttcgacaggaaagcccaagggtgttatgcacaccaccgctggatatctc
ctgggtgccgctatgaccggcaagtatgtctttgatatccacgacgacgatcgctttttc
tgtggtggtgacgtcggttggatcactggtcatacctatgttgtgtatgctcctttgctc
ctgggatgctccaccgtcgtctttgagagtaccccagcgtaccccaacttttctcgctac
tgggatgttattgagaaacaccaggtgactcagttctacgtcgctcctacagcattgcgg
ttgttgaagcgcgctggagacgagcacattcaccacaagatggctcacctgcgtatcctg
ggctccgtcggtgagcctatcgctgcagaggtttggaagtggtatttcgagaaggtcgga
aaggaagaggcacacatttgcgatacctactggcagaccgaaactggttcgaacgtcatc
acacctttgggtggaattacccctacgaaacccggtagtgcctcgttgccgttcttcggt
attgagcctgccatcattgaccctgtctccggagaggaaatctcgggcaatgacgtggaa
ggtgtgcttgccttcaagcagccctggcctagcatggcccgcactgtgtggggtgcccac
aagcgttacatggatacctatctgaatgtttataagggctactacttcactggagatgga
gcaggacgtgaccacgacggatactactggatccgcggccgtgttgacgacgtagttaac
gtatccggtcaccggctgtccaccgctgagattgaagctgccctgcttgaacaccatatg
gttgctgaagctgccgtggtcggtattgctgacgaactcactggccaagcggtcaatgca
tttgtgtctctgaaggagggcaatgagacaaatgagcaggtccgtaaagaccttgtcatg
caggttcgcaagtcgattggaccattcgccgctcccaaggccgtctttgtcgttgatgac
ctccctaagactcgcagcggtaagatcatgcgacgtatcctgcggaagatcctgagcggt
gaggaggacagtctgggtgatacttctaccctgtccgatccctcggtagtcgacaagatc
atcgaaaccgttcacaccgcccggggcaaatag

DBGET integrated database retrieval system