KEGG   Aspergillus flavus: AFLA_027530Help
Entry
AFLA_027530       CDS       T01090                                 

Definition
glycerol kinase, putative
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
afv  Aspergillus flavus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AFLA_027530
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AFLA_027530
Exosome [BR:afv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFLA_027530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 565 aa AA seqDB search
MRNPFDMSDLDSLVDEQEEQPYIDIHAYQTHDGNRSLLQPNENRHGDSLKDRFIGAIDTG
TTSSRFIIFDCTGVPVAKYQMEFRQIHEHSGWHEQDPFDLVDSVYTCIEEAMKSFMALGH
SPSEIEAIGVTSQRETTLVWDWETGEPLHNAIAWPDTRTKGLVRELKAQPGADELKNICG
FPLSTYPSSVTLVWMLRNLPEVKKAYDEGRLAFGTVDTWLMYNLNGGPEGNVLVTDVTNA
SRTMFMNLKTLDYDDNLLEFFGIDRKKIRLPKILPSSDPDGYGWVRGGPLDGVPITSCLG
DQSAALVGHCAFTPGTAKNTYGTGCFLLYNVGEEPVISKHGLLSTVGFQLGKHRKAVYAL
EGSVAVAGSGVSFLMNNMGFFRDSRKVSEVAATVPDSGGCVFVTAFSGLFAPYWIDDAKG
TIFGITQHTQRGHIARATMEAACFQTKAILDAMEMDSGHALSELAVDGGMSNSDICMQTQ
ADIIQIPVERPAMHETTALGAAIAAAFAIDIWKDFSELKNMNRANRTTFQPHISAAQSSK
LYKRWSKAVEMSRGWTDPAEEAEEE
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacccttttgatatgtccgacctcgactctcttgtcgatgagcaagaggagcag
ccgtatattgacattcacgcctaccaaacacatgacggcaatcgctctctcctgcagccg
aatgaaaaccgtcatggcgacagcttgaaggatcggtttattggtgccattgacactggc
accacgagctcccgctttatcatctttgactgtactggtgtccccgtcgccaagtaccaa
atggaattccgtcagatccacgagcattcaggatggcacgaacaagacccgttcgacttg
gtggattcggtttacacatgtatcgaggaggcgatgaagtctttcatggctcttggccac
tcaccgtcagagatcgaagccatcggggtcaccagtcagcgagagacaacgcttgtttgg
gattgggagactggcgagccgttgcataacgctatcgcgtggcccgacaccaggaccaag
ggtctagttcgggagctgaaggcccaacccggagcggatgagttgaagaacatctgcggg
tttcccctctcgacttacccctcctccgtcaccttagtatggatgcttcggaatctaccg
gaagtcaagaaggcatatgatgaaggaaggctcgctttcggcactgttgacacgtggctc
atgtataacctgaatggtggtcctgagggaaacgtcttggtgactgatgtgacgaacgca
tcaagaacgatgttcatgaacctgaaaacgcttgattatgacgataatttgttagagttc
ttcggcattgacaggaagaagatcagacttcctaaaattctcccatcatccgacccggac
ggatatggatgggtcagagggggaccgcttgatggtgtcccgatcaccagctgccttggc
gatcagtctgcggcgttagtcggtcattgtgccttcacacctggaacagcgaagaacaca
tatggcacaggatgcttccttctttacaacgttggcgaggagcccgtaatttccaagcat
ggcttgctcagcacagttggattccagctgggtaagcatcggaaagccgtttacgcgctt
gaaggtagtgtggctgttgccggaagtggtgtttccttcctgatgaacaacatgggtttc
ttccgtgattcgcggaaagtaagtgaagtggcagcaacggttccagacagcggaggctgt
gtgtttgtcaccgcgttcagtggtctgtttgcaccttattggattgatgatgctaaggga
actatattcggaataactcagcacacgcagcgtggacacattgctcgtgccaccatggaa
gctgcctgcttccaaactaaggcaatcctcgatgccatggagatggatagcggacacgca
ttgtcggaactcgccgtcgatggtggtatgagtaattccgatatttgcatgcagacccag
gcagatattatccagatccctgttgaacggccagcgatgcacgagactaccgctctaggt
gctgcaatcgcggcggcattcgccattgatatctggaaggactttagcgagctcaagaac
atgaaccgcgccaatcgcacaacattccaaccccatatctccgccgcgcagagctctaag
ttgtataagcgatggagcaaggcagtcgagatgtctcgaggctggacagatcccgctgaa
gaggcagaggaggaatga

DBGET integrated database retrieval system