KEGG   Aspergillus flavus: AFLA_027950Help
Entry
AFLA_027950       CDS       T01090                                 

Definition
formamidopyrimidine-DNA glycosylase, putative
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
afv  Aspergillus flavus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:afv03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 369 aa AA seqDB search
MPELAEVSRIVHFIRQHLVGKTLAKVSTQNDDIVYGKAGTSASEFQKAMEGKKIVGAGQQ
GKYFWIAMASPPHVVMHFGMAGWLKIRNADTYYYRTDKPQDKEWPPKYWKFLLETDEDPK
TEAAFVDFRRLGRIRLVDCPAEQIRKFSPLKENGPDPVADKDTVTEDWLASKLRSKKVPV
KALLLDQANISGIGNWMGDEILYHARIHPEQYSNTLTDDQVKELHSALHYVCSISVDLLA
DSEKFPEDWLFKYRWSKGKKNASPTLPNGDKITFLTVGGRTSAVVPSVQKKTGPVSKDIK
TEDDGTQNKRKRGIVPKVESDAEASEEEPKAKKAGSKKGAQPTKKADDEKKPEVDGTSAG
RRRSARLKK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagctagccgaagtctcacgtatcgtccatttcatacgccagcatcttgtcggc
aagaccctcgccaaggtatctacgcaaaatgatgacattgtctatggtaaagcggggacg
agtgcctcggaatttcagaaagcaatggaaggaaagaagatcgttggtgcagggcagcaa
ggcaaatacttctggatagccatggcgtcgccgccgcatgtcgtaatgcattttggcatg
gcaggctggctgaaaattcgaaatgctgatacatactactaccggactgacaagccacaa
gacaaagaatggcccccaaagtactggaagttcttgctggaaacggatgaggacccaaag
acagaggctgcatttgttgacttccgcagactaggcaggataagactggtggactgtcct
gcggagcagattcggaagttcagccccctcaaagagaacggcccagaccctgtagcggat
aaggacacggtgacagaagactggctggcgagcaagctaaggagcaaaaaggtccccgtc
aaggctttacttttggaccaagcgaacataagcgggattgggaattggatgggagatgag
attctctaccatgcaagaattcacccagagcaatacagcaacaccttgactgacgatcaa
gtcaaagaacttcactcagcccttcattacgtctgctcaatctcagtggatttgctagca
gattccgaaaagtttcctgaggattggctgttcaaataccgatggtcgaaagggaagaag
aatgcctctcccactctaccgaatggtgataagattaccttccttactgtcggtggtagg
acaagtgctgtggtcccaagtgtgcagaaaaagaccggtcctgtatcgaaggacatcaag
actgaggatgacggtacgcagaataaacggaagcgaggaatagtgcctaaagttgaaagt
gatgcggaggcaagcgaggaagagccaaaggcgaagaaagcaggatcaaaaaaaggagcc
caaccgaccaagaaagccgacgacgagaagaaacccgaagtagacggtacatcggctggg
agaaggcgttctgctcggctcaagaaatga

DBGET integrated database retrieval system