KEGG   Aspergillus flavus: AFLA_028740Help
Entry
AFLA_028740       CDS       T01090                                 

Definition
coenzyme A transferase, putative
Orthology
K01027  
3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
afv  Aspergillus flavus
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AFLA_028740
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AFLA_028740
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AFLA_028740
Enzymes [BR:afv01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     AFLA_028740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 515 aa AA seqDB search
MSRPFLSMFRPVGRRNFSVSTSRRAIDKLCESAQEAVKDLKGSSTLLVGGFGFSGVPNTL
INAVRDRPEVTDLTVVSNNAGMPGAGLGQLLESGQIGKMIASFIGENKVFEKMYLNGDLA
LELTPQGTIAEKCAAGAAGVPAFYTPAAYGTIVQTGELPVRYNKDGTVAETSKPKETREF
NGKNYILEEAIFGDYALVKVHKADKLGNCQFRKAMNNFNEAMAKNAKYTIVEADHIVEVG
EIDPEDIHLQGIYVNKVIQSQGEKQIEKLTFAKDPSEMLKAGESNLISHNHLGSGEATAR
RERIVKRAAKEFRDGMYVNLGIGMPLIAPSYLPEGVEVVLQAENGILGLGGYPKPGEEDP
DLINPGKETVTLASGASVFGSHESFGMIRSGRIDLTMLGALQVSQYGDLANFMLPGKVKG
VGGAMDLVANPEKTKVVVTMEHVDKKGNPKILPECSFPLTGPRCVWKIITDLAVFEVSPT
EGLTLAEHAEGVSVEEIRSKTAAPFKVADDLKPML
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgacctttcctctccatgttccgccctgtagggcggcggaacttctccgtctca
acctcaagaagagcaatcgataagctatgtgaatcagctcaggaagccgttaaggacttg
aagggctcctccactctccttgttggaggttttggtttctcgggtgtgcccaatactttg
atcaacgctgtgcgtgatcgtccggaggtcactgatttgaccgtggtctccaacaatgcc
ggcatgccgggtgctggtcttggacagttactggaatccggacaaattggtaaaatgatt
gcttcgttcatcggtgaaaacaaggtctttgaaaaaatgtatctgaatggtgacctcgcg
ttggaactcactccccagggtaccattgctgaaaagtgtgctgctggtgcagctggtgtc
cctgctttctatactcccgcggcttatggaacaattgtgcaaactggtgaactccccgta
cgttacaacaaggatggcactgtggcggaaacgtccaagcctaaggaaacccgcgagttc
aacggcaagaactacattctggaagaggcaattttcggtgactacgctctggttaaggtt
cacaaggccgataagcttggtaactgccagttccgtaaggcgatgaacaacttcaacgag
gccatggccaagaacgccaagtacaccattgttgaagcggaccacattgtcgaagtcgga
gagatcgaccccgaggatatccacctgcagggaatctacgtcaacaaggtcattcagagc
cagggtgaaaagcagattgagaagctcacattcgctaaggaccctagcgagatgctcaag
gccggtgagtccaatctcatttctcataaccacctaggttccggtgaagccaccgcccgt
cgtgagcgtatcgtcaagcgtgctgccaaggaattccgcgacggaatgtatgttaacctg
ggtattggaatgcccctgatcgctccttcgtatctccctgaaggcgtggaggttgttctc
caggccgagaacggtattctgggactgggtggttaccctaagccgggtgaggaggaccct
gacctcatcaaccctggtaaggagactgtcaccctggccagtggtgcttctgtgttcggc
tctcacgagagctttggtatgattcgctctggtcgtattgatcttactatgcttggtgct
ctccaagtgagccagtacggagatctcgcgaactttatgcttcctggtaaggtgaagggt
gttggtggcgccatggacttggtcgccaatcctgagaagaccaaggtcgttgtgactatg
gagcacgtcgacaagaagggcaaccccaagatcttgcctgagtgctctttccccctgact
ggcccccgctgcgtgtggaagatcatcactgatctggccgtctttgaagtcagccccacc
gagggtctgacccttgctgaacacgctgagggtgtctctgttgaggagatccgcagcaag
actgccgctcctttcaaggttgcggatgacttgaagcccatgttgtaa

DBGET integrated database retrieval system