KEGG   Aspergillus flavus: AFLA_028740Help
Entry
AFLA_028740       CDS       T01090                                 

Definition
coenzyme A transferase, putative
Orthology
K01027  
3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
afv  Aspergillus flavus
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:afv00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:afv00072]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:afv00280]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 515 aa AA seqDB search
MSRPFLSMFRPVGRRNFSVSTSRRAIDKLCESAQEAVKDLKGSSTLLVGGFGFSGVPNTL
INAVRDRPEVTDLTVVSNNAGMPGAGLGQLLESGQIGKMIASFIGENKVFEKMYLNGDLA
LELTPQGTIAEKCAAGAAGVPAFYTPAAYGTIVQTGELPVRYNKDGTVAETSKPKETREF
NGKNYILEEAIFGDYALVKVHKADKLGNCQFRKAMNNFNEAMAKNAKYTIVEADHIVEVG
EIDPEDIHLQGIYVNKVIQSQGEKQIEKLTFAKDPSEMLKAGESNLISHNHLGSGEATAR
RERIVKRAAKEFRDGMYVNLGIGMPLIAPSYLPEGVEVVLQAENGILGLGGYPKPGEEDP
DLINPGKETVTLASGASVFGSHESFGMIRSGRIDLTMLGALQVSQYGDLANFMLPGKVKG
VGGAMDLVANPEKTKVVVTMEHVDKKGNPKILPECSFPLTGPRCVWKIITDLAVFEVSPT
EGLTLAEHAEGVSVEEIRSKTAAPFKVADDLKPML
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgacctttcctctccatgttccgccctgtagggcggcggaacttctccgtctca
acctcaagaagagcaatcgataagctatgtgaatcagctcaggaagccgttaaggacttg
aagggctcctccactctccttgttggaggttttggtttctcgggtgtgcccaatactttg
atcaacgctgtgcgtgatcgtccggaggtcactgatttgaccgtggtctccaacaatgcc
ggcatgccgggtgctggtcttggacagttactggaatccggacaaattggtaaaatgatt
gcttcgttcatcggtgaaaacaaggtctttgaaaaaatgtatctgaatggtgacctcgcg
ttggaactcactccccagggtaccattgctgaaaagtgtgctgctggtgcagctggtgtc
cctgctttctatactcccgcggcttatggaacaattgtgcaaactggtgaactccccgta
cgttacaacaaggatggcactgtggcggaaacgtccaagcctaaggaaacccgcgagttc
aacggcaagaactacattctggaagaggcaattttcggtgactacgctctggttaaggtt
cacaaggccgataagcttggtaactgccagttccgtaaggcgatgaacaacttcaacgag
gccatggccaagaacgccaagtacaccattgttgaagcggaccacattgtcgaagtcgga
gagatcgaccccgaggatatccacctgcagggaatctacgtcaacaaggtcattcagagc
cagggtgaaaagcagattgagaagctcacattcgctaaggaccctagcgagatgctcaag
gccggtgagtccaatctcatttctcataaccacctaggttccggtgaagccaccgcccgt
cgtgagcgtatcgtcaagcgtgctgccaaggaattccgcgacggaatgtatgttaacctg
ggtattggaatgcccctgatcgctccttcgtatctccctgaaggcgtggaggttgttctc
caggccgagaacggtattctgggactgggtggttaccctaagccgggtgaggaggaccct
gacctcatcaaccctggtaaggagactgtcaccctggccagtggtgcttctgtgttcggc
tctcacgagagctttggtatgattcgctctggtcgtattgatcttactatgcttggtgct
ctccaagtgagccagtacggagatctcgcgaactttatgcttcctggtaaggtgaagggt
gttggtggcgccatggacttggtcgccaatcctgagaagaccaaggtcgttgtgactatg
gagcacgtcgacaagaagggcaaccccaagatcttgcctgagtgctctttccccctgact
ggcccccgctgcgtgtggaagatcatcactgatctggccgtctttgaagtcagccccacc
gagggtctgacccttgctgaacacgctgagggtgtctctgttgaggagatccgcagcaag
actgccgctcctttcaaggttgcggatgacttgaagcccatgttgtaa

DBGET integrated database retrieval system