KEGG   Aspergillus flavus: AFLA_029910Help
Entry
AFLA_029910       CDS       T01090                                 

Definition
disulfide isomerase, putative
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
afv  Aspergillus flavus
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:afv00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AFLA_029910
Enzymes [BR:afv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AFLA_029910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 471 aa AA seqDB search
MWQPSSALLLVASLLTALPVNADGLYTKKSPVLQVDHKSYDRLIAKSNHASVRFYAPWCG
HCQNLKPAYEKAAKNLDGLANVAAVNCDDDENKPLCGRLGIQGFPTLKIVTPSKKPGAPR
VEDYQGQRTAKAIVDAVVDRIPNHVKRVTDKDLDKWLSEDEKAPKAILFTEKGTTSALIR
ALAIDFLGSIKVAQIRSKESDAVERFGIEEFPKLVLLPGGEKEHIVYDGELKKKPMVEFL
SQVAAPNAAPSATSSKSSKPSKSSSARSQSTTVLDDEAENLKPTESPDPKVVPDNAQESK
PAQVPIQAPPITSLPTVEALESACLTPKSGTCILALLPESTEADADIPSSAKEAVVSLSE
IVHKHAVRQAHLFPFYSIPAINSGAATLRAGLGLPEDSKSVEIIALNGRRGWWRRYDPSD
NADYSLARVESWVDAIRLGEGSKSKLPEGVIVTEVEPEAEPEKPTADHDEL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagccaagctctgcacttcttcttgtcgcgtcacttctcactgctctcccagtc
aacgctgatgggctgtacactaaaaaatcgcctgtgctgcaggtggatcacaagtcttat
gatcggctcattgccaagtccaatcacgcatcggtaagattttacgctccctggtgtggc
cactgccaaaatctgaaacctgcctacgagaaagcagccaagaacttggacggtttggcc
aacgttgccgctgtcaactgtgacgatgacgaaaacaaacctctgtgtggccggttgggt
atacagggcttcccgaccctcaagatagtgacaccttccaagaaacctggcgcaccaagg
gtggaagattaccagggccagaggaccgccaaagctatagtcgatgcagtggtggaccgc
atcccaaaccatgtgaagagggttacggacaaggacctggacaaatggctttccgaagat
gaaaaagccccgaaagctatccttttcaccgagaaaggcaccacgagtgctctcatcaga
gcccttgcgattgacttccttggatcaatcaaggtagcccagattcgtagcaaggagtcc
gatgctgtagagagatttggcattgaggagttcccaaaacttgtcctcctccccggaggc
gagaaggagcacattgtgtatgatggggaactcaaaaagaagccaatggttgagttcctc
agccaagtcgcggcccccaacgctgctccctctgccacaagctccaagtcatcaaagcca
tccaagtcatcgtccgcgcgctctcagtctacaacggttctagatgatgaagcagagaac
ttgaagccaaccgagtctcctgaccctaaagttgtccccgataatgctcaggaatcgaaa
cctgcacaggtccccattcaggcaccccccattacttcccttcctactgtggaagcgctg
gagtctgcttgtctgacccccaaatccggcacttgtattttggctcttcttccagaatcc
accgaagctgacgccgacatccccagctccgccaaggaggccgttgtcagtttatccgag
atcgtacataagcacgcggtgcgccaggcgcacctcttcccgttctacagtatcccagct
attaacagcggggccgcaactctgcgtgctggtctcggtcttcctgaagatagcaagtca
gtggagatcatcgcgttgaacggacgcagaggctggtggcggaggtacgacccatcggac
aacgcggactacagtttggcccgtgttgagtcctgggtggacgctattcgcttgggcgaa
ggttctaagagcaagcttcctgaaggggtcatcgtcactgaggtcgagcctgaggcggag
cctgagaaaccaaccgccgatcacgacgagctgtaa

DBGET integrated database retrieval system