KEGG   Aspergillus flavus: AFLA_030250Help
Entry
AFLA_030250       CDS       T01090                                 

Definition
(RefSeq) C-14 sterol reductase, putative
  KO
K00213  7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
afv  Aspergillus flavus
Pathway
afv00100  Steroid biosynthesis
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    AFLA_030250
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     AFLA_030250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT
Motif
Other DBs
NCBI-GeneID: 7919391
NCBI-ProteinID: XP_002374535
UniProt: B8N1G0
Position
Unknown
AA seq 438 aa AA seqDB search
MLQNRASSATRVSSKPHLYLQADGKQQKSGNSFWGRRNHVSAFSGLLSLLFVIATSLFVL
FLCVCLEHFDGSLRQGLYELLVHSSPTTLLRRYEPEISYGHVVAYTTWIVFQALLYSLLP
GKTVYGPPTPGGNTLPYRVNGLLSWGITVGAVFLAACIGGAEVVASLAQNWAAVLAAECL
NFIAFYMMFRDRGLKGSVRLMDSGSVFHDYMVGVELNPRLGQHWDLKMFQVGRLGMNSWV
VIDLSFMAQQYLRYGSISNSILIVVILHAIYVVDFFINEDWYLATIDIAHDHFGFTLAWG
TAVWLPMVYTVQAQYLALHPVDLSSLAFSAILITGLVSYVLFRLANHQKHLFRQTRGNCQ
IAGSKPRTIRAQYTTAKGKVHETSLLCSGCWGIVRHPNYVGDIVFSFCTCSPLSKIYAIC
SAEEEEKLMGLCPAGTEI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctccagaatcgagcatcatccgctactagggtcagcagcaaaccacatctctatttg
caagccgatggaaagcagcagaaatcgggaaacagtttttggggccgtcgcaatcatgtt
tctgctttttctggcctcctcagtttgttatttgtaattgctacctcccttttcgtgcta
tttctttgcgtctgcctcgagcatttcgacggctctttacggcagggcttgtatgagtta
ctggttcattcatccccgacaacccttcttcggcgctatgaacctgaaatatcctatggc
catgtggtggcgtatacgacctggatagtctttcaggcgctgttgtactcccttctccca
gggaagaccgtctatggaccgccaacaccgggaggcaatacgctgccctaccgcgtgaac
ggactgttgtcgtggggtatcacagttggtgcagtcttcctggccgcttgtataggaggt
gctgaggtagttgcaagcttagcccaaaattgggcagccgtgttagcggcagaatgttta
aactttatagccttctatatgatgtttcgagacagggggttgaaggggagtgttcgacta
atggattcaggctctgtttttcacgattatatggttggagtcgaactgaatccccgactg
ggtcagcactgggatctgaagatgttccaagtcggccgcctaggaatgaactcatgggtg
gtgatcgacctatctttcatggctcaacaatacctccgttacggctcaatctctaactca
atccttattgtggtcattctccatgctatctacgtcgttgactttttcatcaacgaagat
tggtaccttgcaaccatagatattgcccatgaccacttcggtttcaccctagcctggggc
actgccgtttggttacccatggtctacaccgtgcaagcccagtatttggccttgcatcca
gtcgacctctcttcattggcattcagcgcaatccttataacaggtctcgtgagctacgtg
ctgtttcgtctcgccaaccaccagaaacaccttttccgacaaacgcggggcaattgtcag
attgccggcagcaagcctcgcactatcagggctcaatatactacagcgaaggggaaagtc
cacgagacatctttgctgtgttctgggtgctgggggattgtgcgccatcccaactacgtt
ggtgacattgttttctctttctgcacgtgtagtcccttgtcgaagatctacgcgatatgt
tccgcagaggaggaggagaagcttatggggctgtgtccggctggaaccgagatctag

DBGET integrated database retrieval system