KEGG   Aspergillus flavus: AFLA_030770Help
Entry
AFLA_030770       CDS       T01090                                 

Definition
beta-N-acetylglucosaminidase, putative
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
afv  Aspergillus flavus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFLA_030770
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AFLA_030770
Enzymes [BR:afv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AFLA_030770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 835 aa AA seqDB search
MVWGALSFSNETSAMQPSCNQSLTHSLQEEARLAGHDYPLFIGIDQENGLVTRISPPIAA
QLPGPMALGATYASELAKEVGTVTGETLRLFGINMNYAPVCDINSEPLNPVIGVRSFGDH
PGLVGRLACATAQGLREQKVVPSVKHFPGHGDTAVDSHYGLPVISKTREQLDKCELRPFR
RAIAEGIEAVMTAHISLPSVDDSHLPATLSAKALNILRKDMNYDGMVITDCLEMDGIRAS
YGTEQGAVLALGAGCDSIMVCHTYDVQVGSIDKICEAVESGKVPTSRLEEACRRVTALKA
RFLSWDAALKSQGLNGLTSLKQKGAKLAKEAYSSSVTLVRDTQSILPLSPSSKIAFLFPG
DKTPAGGAVDGEGLGRKGSYNASIYLDILKQWNNQAFEIQYGPMGLSTEQLSLVDAADVV
IFASINARESAYQRTLGLELPRHNRPMVAMALCNPYDFLEDSFIQTYVATYEPTIEAFTV
AVELLFRPHLAKGSLPVGPEKPAPRWLEVQQYAAATDFSQVYDVWLAALPSYRVSADNLT
EAITPPPHVLPVESHHLVARTSYPESKVVGFCLLFVAAQQDTVCVQLAALAVDPKLQGRG
VGTALLAECRAWMEKTFKKSRLELGSTFPRFWPGLPIDLPTEVQEFFVHRGFQLNPPVPR
SVDLYQDIKEFQSPELYVTRAKERGYTFRPLETADYQECLVGQEKNFSYNQAWVQMFHKL
DPSKYPSSVMTAFDPNGKQVGWTLMLSHESPMLKPHWAFPSLCGPKTGLIGCVGVDADYR
KEGVGLALLCHAIEDMKQRGVEGVFVDWVSLEGWYEKLGFKVWWSCRTGAMQLDA
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggtttggggggcattgtccttttcaaacgaaacatcagcgatgcagcccagttgcaac
cagtctttaactcactctttacaagaagaagcgaggctagctgggcatgattatccctta
tttatcggtattgaccaagagaatggattggtcactcggatttcacctcctattgccgct
caactcccggggcctatggctctcggagcgacctatgcctcggagcttgctaaggaagtc
ggcaccgtcacgggcgagacgctgagactatttgggatcaacatgaactatgctcctgtg
tgcgacattaactcagaacccctaaacccagtgatcggagtccgcagttttggagaccat
cctggattggtgggaagattggcatgcgccactgcccaaggactccgagaacaaaaggtg
gtacccagcgtcaagcatttcccagggcacggagacactgctgtggactcccattatggc
cttcctgtcatctctaagacgagagaacagctagataaatgtgaattgagaccatttcgc
agagctatagctgaaggtattgaggcagtgatgactgcccacatttcgctaccttctgtt
gacgatagtcatctccctgctacactttctgctaaagccttgaatatactacggaaggat
atgaactacgatggcatggtgatcacagactgtctagagatggatggtatccgtgcctca
tacggtactgagcagggggcagtcctcgctttaggagctggctgtgacagcattatggtc
tgtcacacttatgatgtccaggtaggatctatcgacaagatctgcgaggctgtagaatcc
ggaaaggtgccaacttcgcgtctggaggaagcttgtcgcagagtgactgcactaaaagcc
cgttttctgagttgggacgcagcgctcaagtcacagggccttaatgggcttacgtctctt
aagcaaaagggcgcaaagttagcgaaagaagcctattctagctcggtcactcttgtgcgc
gatacacagagtatccttcccctctctccttcgtcgaagattgcatttctctttccgggt
gacaagacaccggctggcggtgcagtggatggggaaggtttgggcagaaagggatcgtat
aatgcctccatttatctcgatattcttaaacaatggaataaccaagccttcgagattcaa
tacgggccaatgggtctatcgactgagcagcttagtcttgtcgacgctgcagatgtggtc
atattcgcgtctatcaatgcacgggaatcggcatatcaaagaacgttgggtctcgaactg
ccgcgccacaatcgtccaatggttgctatggcactctgtaatccttatgactttctggag
gattcatttattcagacctacgtcgctacctacgagccaacgatagaggcttttacagta
gctgtggagcttctctttaggccgcatctcgcaaaggggtctctacctgttgggccagaa
aagcctgcaccacgttggcttgaagtacaacaatacgcagctgcaactgacttttcccag
gtatatgatgtatggctcgcagccctgcccagttacagagtatctgcagacaatttaact
gaagcgataacgcctccgcctcatgttcttccagtcgaatcacaccatctcgttgctagg
acaagctacccggagtccaaagtcgttggattttgcctcctcttcgtagccgcccagcag
gatactgtctgtgtccaacttgcagcacttgcggttgatccgaaattacagggtcgggga
gtggggactgccttacttgcagagtgtcgggcttggatggagaaaacattcaagaaatcc
cgtctagaactgggaagcacattcccacgtttctggcctgggcttcccattgacctgccg
acggaggtccaggaattctttgtccatcggggattccagctaaaccccccagtcccgcgg
tctgttgatctctatcaagacatcaaagaattccaaagcccagagctgtacgtcactcga
gctaaggagcgaggttataccttccgtcctctagaaactgccgactaccaagaatgtctt
gttggccaggagaagaacttctcatataaccaagcctgggttcagatgttccataaactt
gaccctagcaaatacccgtctagtgtgatgaccgcatttgaccccaacgggaagcaagtg
ggctggacactaatgctttcccatgagtctcctatgctcaagccgcattgggcattccct
tctctctgtgggcccaagaccggcctcatcggttgtgtcggtgtcgacgcagattatcgc
aaggagggagttgggcttgccttactctgccatgcgatcgaagatatgaagcagagagga
gttgaaggagtttttgttgactgggtgagcctcgaaggatggtatgagaagctcgggttc
aaggtttggtggagttgccgaacgggggcgatgcaacttgacgcttga

DBGET integrated database retrieval system