KEGG   Aspergillus flavus: AFLA_031200Help
Entry
AFLA_031200       CDS       T01090                                 

Definition
(RefSeq) arginase, putative
  KO
K01476  arginase [EC:3.5.3.1]
Organism
afv  Aspergillus flavus
Pathway
afv00220  Arginine biosynthesis
afv00330  Arginine and proline metabolism
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
afv01130  Biosynthesis of antibiotics
afv01230  Biosynthesis of amino acids
Module
afv_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    AFLA_031200
   00330 Arginine and proline metabolism
    AFLA_031200
Enzymes [BR:afv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AFLA_031200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 7921687
NCBI-ProteinID: XP_002374630
UniProt: B8N3N6
Position
Unknown
AA seq 324 aa AA seqDB search
MTQPSTITQRFLSKPGNLGVVAVGFNGGQCKLGVEAAPMALVEAGLLDQLRDDLGYTLDY
DGTVHYYENQIPAEDPDHRGMKKPRAVSAVTEALSAQVYEKAKQGQMVLTLGGDHSIAIG
SISGSAKATRERLGRELAVIWVDAHADINIPEMSPSGNIHGMPMAFLTRLAREEQKDIFG
WLQDEHIVSTRKLVYIGLRDVDRGEKQILREHGIKAFSMHDIDRYGIGRVVEMALAHIGN
DTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICECVHETGNLVAMDLVEVNPSLE
SVGASETIRTGCSLVRSALGDTLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaccctccaccatcacacaacgcttcctgtccaagcccggaaatctgggtgtg
gtagcagtcggcttcaatggcggccagtgcaaacttggagttgaggctgcccccatggcc
ctggtcgaggctggcctcctcgatcaactccgcgacgaccttggctacaccctcgactat
gacggcaccgtccactactacgaaaaccagatccccgccgaagatcccgaccaccgcggc
atgaagaagccgcgcgctgtgagcgccgtgaccgaagcgctgagcgcacaggtctacgag
aaagccaagcagggtcagatggtcttgacactgggaggtgatcactcgatcgccatcgga
tccatctccggctcagccaaggctacccgcgaacgcctgggtcgggagctggccgtcatc
tgggttgatgcgcacgccgatatcaacattccggagatgagccctagtggaaacatccac
ggtatgcccatggcgttcttgacgcgcttggcccgcgaggagcagaaggacatcttcggc
tggttgcaggatgagcacatcgtcagcacccgtaagctggtctacattggtctgcgcgat
gttgatcgcggcgagaagcaaatccttcgggagcatggcattaaggcgttcagcatgcac
gacattgaccggtacggtattggccgtgtggttgagatggctctggcccacatcggaaac
gatacccctattcacctttcattcgacgtcgatgctctggatccgcagtgggctcccagc
accggcactcccgtgcgtggcggtctgactcttcgtgagggtgatttcatctgcgagtgt
gtgcatgagacgggcaacctggtcgccatggacttggtggaggtcaaccccagcttggag
tcggtaggcgcctccgaaaccattcggaccggttgctcgttagtgcgcagtgcactgggt
gacaccctcctgtga

DBGET integrated database retrieval system