KEGG   Aspergillus flavus: AFLA_034170Help
Entry
AFLA_034170       CDS       T01090                                 

Definition
MAP kinase FUS3/KSS1
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
afv  Aspergillus flavus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 354 aa AA seqDB search
MVQQLPPQGGSRKISFNVSDQYEIQDVIGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSM
FCLRTLREMKLLRYFNHENIISILDIQRPRNYESFNEVYLIQELMETDMHRVIRTQDLSD
DHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTDDNSGF
MTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDV
LGTPTMEDYYGIKSRRAREYIRSLPFKKKIPFKALFPKANDLALDLLERLLAFNPAKRIT
VEEALRHPYLEPYHDPEDEPTAPPIPEGFFDFDKNKDALSKEQLKILIYEEIMR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagcaacttcctccccagggaggttcacgaaagatctccttcaacgtttccgac
caatatgaaattcaagatgtcattggtgaaggtgcctacggtgtggtgtgctctgccatc
cacaaaccatctggtcaaaaagtcgccatcaagaagatcactcctttcgaccactcgatg
ttctgcttgcgaactttgcgtgagatgaagctgcttcgctattttaaccatgaaaacatc
atctctatcctggatatccaaagaccacgcaactatgagagcttcaacgaggtttatcta
atccaggagctgatggagactgacatgcaccgggtcattcgtacccaagatctttcggat
gatcactgtcaatattttatttaccagactctacgtgccctcaaagctatgcactcggcc
aatgttcttcatcgtgatctgaaaccttcgaacctgctcctcaacgcaaattgcgatctg
aaagtttgcgattttggcttggcccgctcggccgcctccacagatgataactcagggttc
atgacagaatatgtggcgaccagatggtaccgtgcgccggagattatgttgacattcaag
gagtacaccaaagcgattgatgtgtggagtgttggttgtattctcgccgagatgctgagc
ggaaaacccttattccccggaaaggactatcatcaccaattgactcttattttggacgtt
cttggtacaccgacaatggaggactactatggaatcaaatcccgacgggctcgggaatac
attcggtctctccctttcaaaaagaagatccccttcaaggcgctcttcccgaaggccaac
gatttggccctggacctcctggagaggctcttggcattcaaccccgctaagcgtattact
gtggaagaagctttgcgtcatccatacctggagccgtatcatgaccccgaagatgagccc
acggcacctcccatcccggaagggttcttcgactttgacaagaataaggatgcccttagc
aaggagcagttaaagattctaatctacgaggagatcatgcggtga

DBGET integrated database retrieval system