KEGG   Aspergillus flavus: AFLA_037490Help
Entry
AFLA_037490       CDS       T01090                                 

Definition
eukaryotic translation initiation factor 3 subunit EifCj, putative
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
afv  Aspergillus flavus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:afv00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFLA_037490
Translation factors [BR:afv03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AFLA_037490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 265 aa AA seqDB search
MAPERWDDEEDSVSPPPVAPRRRFDDEEEDEVLDSWDAAEDSEVEREKAAKAAEAKAKAD
AEAAAKKKSKSQRIQEHKEERKKKAEEEDSDSEEEDDADKRARLRRAQKDADLKHAEDLF
GDIDLNRNRGAPKAIVISDSADPTQAVDLSAMPLFKPTTKEQFARLTSTLIPLLTPHSKK
PHYSLWAQEFAKQLVKELNSADVKKIASAMTTMSNEKMREERAADKGSKKSKAAKTKVSL
VTSRDNKLDADYDNGDDGLGDDDFM
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgaacggtgggacgatgaggaggacagtgtctcccctcctcctgtggctcct
cgtcgcagattcgacgatgaagaagaagatgaggtcctcgactcctgggacgccgctgaa
gactccgaagtagagcgggaaaaggcagccaaagcggccgaagccaaggctaaggccgac
gccgaagctgccgcaaagaagaagagcaagtcgcagcgtatacaggaacacaaggaggag
cgcaaaaagaaggccgaagaggaggattccgacagcgaggaggaggacgatgccgacaag
agagcccgtctgcgccgcgcccagaaggatgccgatctcaagcacgctgaagatctgttc
ggtgatatcgacctcaaccggaaccgcggcgcccccaaggctatcgttattagtgactcg
gccgacccgacgcaggccgtcgatctttctgccatgcctttattcaagcctaccactaag
gagcagttcgctcgtttgacttccacccttatcccgctcctgactccccattcgaagaag
cctcactattccctgtgggcgcaggagtttgctaagcagcttgttaaggagctgaacagc
gcagatgtcaagaagatcgctagtgctatgactactatgagcaacgagaagatgagagag
gagcgcgccgctgacaagggcagcaagaagagcaaggcggccaagacgaaggtgtcactg
gttacttccagagataacaagcttgatgctgattatgacaatggtgatgatggattgggt
gatgacgatttcatgtga

DBGET integrated database retrieval system