KEGG   Aspergillus flavus: AFLA_043800Help
Entry
AFLA_043800       CDS       T01090                                 

Definition
(RefSeq) arginase, putative
  KO
K01476  arginase [EC:3.5.3.1]
Organism
afv  Aspergillus flavus
Pathway
afv00220  Arginine biosynthesis
afv00330  Arginine and proline metabolism
afv01100  Metabolic pathways
afv01110  Biosynthesis of secondary metabolites
afv01130  Biosynthesis of antibiotics
afv01230  Biosynthesis of amino acids
Module
afv_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    AFLA_043800
   00330 Arginine and proline metabolism
    AFLA_043800
Enzymes [BR:afv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AFLA_043800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 7916138
NCBI-ProteinID: XP_002377842
UniProt: B8NB05
Position
Unknown
AA seq 295 aa AA seqDB search
MPTNTITLIISPYHVGLRDHRVGNGPHRIQSQGLIPTLKQQGLQIRIHEIPSVDNFEGEI
GRSFEILRRISVAVTEAVDNNTFPLILAGNCMSSAAVACGLKIHDLSFIYFDAHDDLDSP
DVNENGYFDAMGLSMLRGESWKTLMGTVPNYKPFSYEDRFLYCGLRDQSDVQRQRVIEAG
MKAVWGETARKVDFVGELRTQMEERSYGSALVHLDLDVLDESYGKVNDYPSPGGLTEEDL
VACMDLVPRLSEPRSLTVCSFDPDVGDGDTIARIGIRAIRAFVGALLETGVLIRG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccaacaccataaccctaatcatctcaccttaccacgtcggcctgcgggatcac
cgcgtaggcaacggcccccaccgcatccaatcccagggcttaatccccaccctcaaacaa
cagggcctccaaattcgcatccacgaaatccccagcgtggacaacttcgaaggcgagatc
ggccgaagcttcgagatcctccgccggatttcagtcgctgtcacagaagccgtggacaac
aacaccttcccgttaattctggcgggaaattgcatgtccagcgcggcggtggcttgcggc
ctgaagatccacgatctatcgtttatttacttcgatgctcatgatgacctggactcaccg
gatgtcaatgaaaatgggtactttgatgccatgggtttgtccatgctacggggtgaatcg
tggaagacgttaatggggaccgtgccgaattataagccgtttagttacgaggaccggttt
ctttactgtgggttgcgggatcagtctgatgtgcagcggcagagggttattgaggccggg
atgaaggctgtttggggggagacggcgaggaaggttgattttgtgggtgagttgaggacg
cagatggaggagaggtcgtatgggtctgctcttgtgcatctggatctggatgtcttggat
gagtcttatgggaaggttaatgattatccgtcgccgggaggtttgacggaggaggatttg
gtggcttgtatggatctggtgccgaggctgtctgagcctaggtctttgacggtgtgttcg
tttgatccggatgttggggatggggatacgattgctaggattgggattcgggcgatcaga
gctttcgtgggggctttgttagagacgggggttctgattaggggttga

DBGET integrated database retrieval system