KEGG   Aspergillus flavus: AFLA_044090Help
Entry
AFLA_044090       CDS       T01090                                 

Definition
urate oxydase UaZ
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
afv  Aspergillus flavus
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AFLA_044090
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    AFLA_044090
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     AFLA_044090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 302 aa AA seqDB search
MSAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDS
IKNTIYITAKQNPVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHS
FIRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILS
TDVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMAEQIL
ARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKS
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagtaaaagcagcccgctacggcaaggacaatgtccgcgtctacaaggttcac
aaggacgagaagaccggtgtccagacggtgtacgagatgaccgtctgtgtgcttctggag
ggtgagattgagacctcttacaccaaggccgacaacagcgtcattgtcgcaaccgactcc
attaagaacaccatttacatcaccgccaagcagaaccccgttactcctcccgagctgttc
ggctccatcctgggcacacacttcattgagaagtacaaccacatccatgccgctcacgtc
aacattgtctgccaccgctggacccggatggacattgacggcaagccacaccctcactcc
ttcatccgcgacagcgaggagaagcggaatgtgcaggtggacgtggtcgagggcaagggc
atcgatatcaagtcgtctctgtccggcctgaccgtgctgaagagcaccaactcgcagttc
tggggcttcctgcgtgacgagtacaccacacttaaggagacctgggaccgtatcctgagc
accgacgtcgatgccacttggcagtggaagaatttcagtggactccaggaggtccgctcg
cacgtgcctaagttcgatgctacctgggccactgctcgcgaggtcactctgaagactttt
gctgaagataacagtgccagcgtgcaggccactatgtacaagatggcagagcaaatcctg
gcgcgccagcagctgatcgagactgtcgagtactcgttgcctaacaagcactatttcgaa
atcgacctgagctggcacaagggcctccaaaacaccggcaagaacgccgaggtcttcgct
cctcagtcggaccccaacggtctgatcaagtgtaccgtcggccggtcctctctgaagtct
aaattgtaa

DBGET integrated database retrieval system