KEGG   Aspergillus flavus: AFLA_044350Help
Entry
AFLA_044350       CDS       T01090                                 

Definition
TOR pathway phosphatidylinositol 3-kinase TorA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
afv  Aspergillus flavus
Brite
Protein kinases [BR:afv01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   AFLA_044350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2384 aa AA seqDB search
MAQAGPITDVTQRLFVELKSKNEETRARAAYELYDNVLAISRDWPPEKFLEFYNAVSQRI
AQLVVTGSDAHERIGGLLALDRLIDFDGVDAAQKTTRFASYLRSALRSNDNGVLEYAAKA
LGRLAKPGGALTAELVESEIQSALEWLQSERQESRRVAAVLVIRELAKGSPTLLYGFVPQ
IFELIWVALRDPKVVIRETASEAVRECFEIIAARDSQVRKSWFARIYEEALQGLKSNNVD
WIHGSLLVLKELLLKGAMFMNEHYRNACEIVLRLKDHRDQKIRAQVVLTIPILACYAPVD
FTETYLHRFMVYLQAQLKRDKERNEAFIAIGKIANAVGVAIAQYLDGIIVYIREGLAMKA
RNRAGVNEAPMFECISMLSLAVGPALNNYMESLLDPIFACGLSESLTQALFDMAHFIPQI
KPTIQEKLLDMLSLILKGAPFRPLGCPESRLPPIPSFAKDFAPQELHSDAEIALALHTLG
SFDFSGHILNEFVRDVAINYVENDNSEIRKASALTCCQLFVHDPIINQTSSHSIQVVSEV
IDKLLTVGVGDPDSEIRRTVLWSLDRKFDRHLARPENIRCLFLAVNDEVFSVREAAICII
GRLSSVNPAYVFPPLRKLLVNLLTGLGFASTARQKEESAQLISLFVSNATKLIRSYVDPM
VTTLLPKATDTNPGVASTTLKAIGELANVGGGEMKLYLPQLMPVILDSLQDLSSHAKREA
ALRTLGQLASNSGYVIDPYLEYPHLLAVLINIIKTEQTGSLRKETIKLLGILGALDPYKY
QQISETAPDIHHINEVQTVSDVALIMQGLTPSNEEYYPTVVINTLMQNILRENSLAQYHS
AVIDAIVTIFKTLGLKCVPFLGQIIPGFIAVIRGSPPSRLESYFNQMAILVNIVRQHIRA
FLPEIIEVVRDFWDASYQVQATILLLVEAIAKSLEGEFKKYMAGLIPMMLDTLEKDNTPR
RQPSERILHTFLIFGTSGEEYMHLIVPSIVRLFDRTQNPQSIRKTAIDSLTKLSRQVNVS
DFASLMVHSLSRVVAGNDRMLRQAAMDCICALIFQLGQDFSHYIHLLNKVLKRHQITHVN
YHILVTKLQKGDSLPQDLNPDENYAALADDTNFAEIGQKKMVVNQQHLKNAWDASQKSTR
EDWQEWIRRFSVELLKESPSPALRACASLAGIYQPLAKDLFNAAFVSCWTELYDQYQEEL
VRSIEKALTSPNIPPEILQVLLNLAEFMEHDDKALPIDIRTLGKYAAKCHAFAKALHYKE
LEFEQDQNSGAVEALITINNQLQQSDAAIGILRKAQAYRDVELKETWFEKLQRWEEALAA
YKRREKIDPDSFGVTMGKMRCLHALGEWKILSDLAQEKWNQASLEHRRAIAPLAAAAAWG
RGQWELMDSYLGVMKEQSPDRSFFGAILAIHRNQFEEATMYIEKARNGLDTELSALLGES
YNRAYNVVVRVQMLAELEEIITYKQNIGDPEKQDSMRQTWNKRLLGCQQNVEVWQRMLKV
RALVTSPRENLDMWIKFANLCRKSNRMGLAERSLASLETVVSDNNGTRAVAPPEVTYARL
KFSWATGRQREALQMLKEFTTSLTEDFTRFNALMISQSEHNGINGVNGIQDTNHGDIMGL
RERIGDVAKFRRLLAKSYLRQGEWQTSLQKGDWKPEHVREVLNAYSAATKYNRDSYKAWH
SWALANFEVVTTIASQASKDGATLAMVPGHIVTEHVIPAIRGFLRSISLSSTSSLQDTLR
LLTLWFTHGGDQEVNAVVTEGFTAVNIDTWLAVTPQLIARINQPNIRVRSAVHRLLAEVG
KVHPQALVYPLTVAMKSNVARRSQSASSIMDSMRQHSAKLVEQADLVSHELIRVAVLWHE
LWHEGLEEASRLYFGDHNVEGMFATLAPLHEMLDKGAETLREVSFAQAFGRDLAEAKHYC
MLYRETEEIGDLNQAWDLYYTVFRKISRQLPQLSTLDLKYVSPKLKDCVDLDLAVPGTYQ
SGRPIIRIMSFDPILHVLQTKKRPRRMTLKGSDGNSYMYALKGHEDIRQDERVMQLFGLV
NTLLDNDSESFKRHLSVQRFPAIPLSQSSGILGWVSNSDTLHALIKEYRESRRILLNIEH
RIMLQMAPDYDNLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSKSSEAWLERRTNYTRSLG
VMSMVGYILGLGDRHPSNLLLDRITGRVVHIDFGDCFEVAMHREKYPERVPFRLTRMLTF
AMEVSNIEGSYRITCEAVMRVLRENKDSLMAVLEAFIHDPLINWRLGIRESPDRMPFSSE
RRQSIIGNINSEQGVQPSNFSRHRRPSILEGGILDAQEGIPNEAREAQNARALQVLARVK
EKLTGRDFKPSEELNVSDQVDKLLAQATSVENICQHWIGWCSFW
NT seq 7155 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagcaggtcctattacggacgtcactcaacgtctcttcgtcgagttgaagtct
aagaatgaagaaacgcgggcgagagctgcttacgagctttacgataatgtccttgctatc
tcacgagattggcctccggagaaatttcttgaattttacaatgccgtcagccagcgcatt
gcacaacttgttgtcacaggcagcgacgcacatgaacgaatcggtggcctactagcgctg
gatcgcctgatagatttcgatggagtagatgctgcccagaagactacccgatttgccagt
tatctgcgaagcgctctgcgcagcaacgataatggagtgttggaatacgctgccaaagct
ctgggccgtttggctaaaccgggcggagctcttactgcggagcttgttgagagtgaaata
caatcggctttagagtggcttcagtctgaaagacaagagagtcgacgcgttgctgccgta
cttgttatccgcgaacttgccaaagggtcgccaacacttttgtacggctttgtcccccaa
atcttcgagctcatctgggttgcactcagggatccgaaagttgttatccgagaaacagcc
tccgaggcagtcagggaatgcttcgagattatcgctgcaagagactctcaggttcgaaag
tcgtggttcgcgcggatttatgaagaagcactccagggcttgaagtccaacaatgtagat
tggattcacgggtcactactagtcctcaaagagctccttctcaagggtgcaatgtttatg
aatgaacattacaggaatgcttgtgagattgttcttcgtctcaaagatcatcgtgaccaa
aagattcgcgcacaggtcgttttgacaatccctatccttgcttgctatgccccagttgac
ttcacagagacgtatcttcatagatttatggtctaccttcaagcacagctgaagagggac
aaggagcgcaatgaggcattcattgctataggaaagattgcgaacgctgtcggcgtggcc
attgcgcaataccttgatgggatcatcgtttatatcagagaaggcctggccatgaaagca
agaaatcgcgccggtgttaatgaagcgccaatgttcgagtgcatcagcatgttgtcatta
gctgtaggaccggcgcttaacaactacatggaatcgttgctagatccaatctttgcgtgc
gggctaagcgaatcattaactcaggcgctttttgatatggcacattttatcccacaaatc
aagcctactatccaagaaaagcttttggatatgttgagtctgattcttaaaggagccccg
ttccggcctttgggttgcccagagagcagattgccccctattccatcatttgcgaaagac
ttcgccccccaagagttgcattcagatgcagagatagcactagcacttcacactctggga
agcttcgatttctctggtcacattcttaacgagtttgttcgcgatgtcgccatcaactat
gttgagaatgacaactctgaaattcggaaagcttcagcacttacatgctgtcagctattt
gtccacgatccaattatcaatcagactagtagtcactcaatacaggttgttagtgaagtc
attgacaagcttctgacggttggtgtcggcgatcctgattcagagatccggcgcacagtt
ttgtggtcattggatcgcaaattcgaccgccatcttgcacggccagagaatattcgttgt
ttgttccttgcggttaatgatgaagtattttctgtcagagaagctgccatctgcatcatt
gggcgcctctcaagtgtgaatccggcctacgtattcccgcctcttcgaaaactactggtc
aatcttctgacggggcttggatttgccagcacggctcgccaaaaagaagagagtgctcag
cttatcagcttgtttgtctcaaatgcgacaaaactcatcaggtcatatgtcgatcctatg
gtgaccaccttgctcccaaaagccactgacactaaccccggtgtcgcttcgaccacttta
aaagctatcggtgaacttgcaaatgtcgggggaggcgagatgaagttgtacctgccacag
ctgatgcctgtcatattggattcgttgcaggacctctcttcccatgccaagcgggaggca
gccttgcgtacgctgggtcagctagccagcaactctggatacgttattgacccgtatctt
gagtaccctcatctccttgctgtgcttatcaatataatcaagacggaacaaacggggtct
ctgcggaaggagacaatcaaattgctaggtattcttggcgctttggatccgtacaagtac
cagcaaataagtgaaactgcaccagatattcaccatatcaatgaagtccaaactgtctcc
gacgtcgctttgattatgcaagggctcactccttccaatgaagagtactacccgacagtg
gtcatcaacaccttgatgcagaatatacttcgcgaaaactccctcgcccaataccattca
gcggttattgatgctatcgtcactatcttcaaaactttgggattgaagtgcgtgccattt
ttgggacaaataatccctggctttatagccgtaataagaggatcgccccctagccgtttg
gagtcgtactttaaccagatggcgatattggtcaatattgtgagacagcacattcgggcc
ttccttccggagattattgaagttgttcgcgatttctgggatgcatcatatcaagttcaa
gccacgatattattgcttgtggaggccattgccaagtctttagaaggtgaattcaagaaa
tacatggcgggcctcattcccatgatgttggataccctcgagaaggacaacacaccacgt
cgacagccttcagaaaggatacttcacactttcctcatctttggcaccagtggggaggag
tatatgcatttaattgttccctctattgtgcgccttttcgacagaactcaaaacccacag
agcattcggaagaccgccatcgatagtctgacgaaactatcacggcaagtcaatgtatct
gactttgcgtctttgatggtccattccttgtcccgtgttgtcgcgggcaacgatcgaatg
ttgcgacaggccgctatggactgtatttgtgctctcattttccagttgggccaggatttc
agtcactacatccatcttctgaacaaggttttgaaacgtcaccagatcactcatgtcaat
tatcatattctggtgacgaaattacagaaaggagactcacttccgcaggatcttaaccct
gatgagaattatgcagccctggcggatgatactaactttgccgagatcggccagaagaag
atggttgtcaaccagcagcacttgaagaatgcctgggatgcctctcaaaagtcgacacgt
gaggactggcaggagtggatacgacgattcagtgtggaacttttgaaggagtctccttct
ccagccctgcgtgcatgcgccagtctagctggcatttaccagccattggccaaagatctg
ttcaatgctgccttcgtatcctgctggactgagttgtatgaccaataccaggaagagctt
gttcggtcgatcgaaaaggcgctcacgtcacctaatatccctcctgaaatcttgcaggtt
ttgctcaacctcgctgagtttatggagcacgacgacaaagctctccccatcgacatccgc
acacttggcaaatacgctgccaagtgtcacgcatttgctaaagctctccactataaagaa
cttgagttcgaacaggatcaaaattcgggtgcagttgaggctctgattaccatcaacaac
cagcttcaacaatctgatgctgccattggtattcttcggaaagcccaagcttatcgggat
gtggagcttaaggaaacctggttcgaaaagcttcagcgctgggaggaggcccttgctgcc
tataagagacgtgagaagatagacccggattcctttggcgtcacaatgggcaaaatgcgc
tgtctgcacgcccttggtgagtggaaaatattatctgatctcgcccaagagaagtggaat
caggcctcattagaacatcggagagccattgctcctctcgctgctgcggctgcatggggt
cgtggtcaatgggaattgatggattcctacctgggtgttatgaaagaacagtcacccgac
aggtcattctttggtgccattcttgccattcatcggaaccagttcgaggaggcaacgatg
tatatcgagaaagcgcggaatggactcgacaccgaactttcagccttgcttggtgaatca
tataaccgtgcttacaatgtcgtcgtccgcgttcagatgctcgctgaactcgaggaaatc
attacgtacaagcagaacatcggtgatccagagaagcaggattctatgcgccaaacatgg
aacaaacggttacttggctgccaacaaaatgttgaagtatggcagcgtatgctcaaggtt
agagcacttgtcacctcccctcgagaaaaccttgacatgtggattaaattcgccaatctt
tgtcgcaaatccaatcgaatgggacttgctgagcggtctctggcatctctggaaaccgtt
gtttctgacaacaatggtacccgggctgtagctcctccagaggtcacatatgctcgccta
aagttcagctgggctactgggcggcagcgtgaagctcttcagatgcttaaggagttcact
acaagtctcaccgaagacttcacgagattcaatgctctcatgatctctcagtcagagcat
aatggcattaatggcgttaacggcatccaagatacaaaccatggagatataatgggtcta
cgagagcgtattggggatgtggccaagttcagaaggctccttgctaagagctaccttaga
cagggcgagtggcagacttctctacaaaaaggagattggaaaccggagcacgtccgagag
gtcctcaacgcatactctgccgctacgaaatacaaccgtgattcttacaaagcttggcat
tcgtgggcattggccaactttgaagtcgttacaacaatcgcaagccaagctagcaaagat
ggcgcgacattggccatggttcctgggcacattgtaacagagcatgtgataccagctatt
cgtggtttcctcaggtccatatccttgtcgtcaacctcatctttgcaagataccctgagg
ttacttaccctctggtttactcacggtggcgatcaggaagtaaatgccgttgttacagaa
ggtttcacggcggtgaatatcgacacctggctcgcggtaacaccgcaactcatagcacga
attaatcaaccgaatattcgggtccgaagcgctgtccatcgactacttgctgaggtcggt
aaggttcatcctcaggcgctggtgtatccattgactgttgcgatgaaatcaaacgttgcc
cgacggtcgcagtctgcaagtagcatcatggacagtatgcggcaacatagtgcaaaactg
gtcgaacaagctgatcttgtaagtcatgaattgattcgggttgccgttctatggcacgag
ctctggcacgaaggattggaagaagcttcccgcctctatttcggtgaccacaatgtcgaa
ggaatgtttgcaactctagcaccactccatgaaatgcttgataagggggccgaaacgtta
cgcgaagtatccttcgcacaggcgtttggtcgtgaccttgcagaggcaaagcattactgc
atgctataccgtgagaccgaagagattggtgacctgaatcaagcttgggatctctactac
accgtgttccggaagataagcagacagcttccgcaattgtctacacttgacttgaaatat
gtctctcctaaacttaaagactgtgtcgaccttgatcttgctgttccgggcacctaccag
agtggccgaccgatcatccgtatcatgagcttcgatcctatacttcatgtccttcaaacc
aagaaacgaccacgcagaatgaccctgaaaggtagcgatggtaattcatacatgtacgca
cttaagggacatgaagatattagacaagatgagcgagtcatgcagctctttggcctcgtg
aatacgctccttgacaatgacagtgagagctttaaacgccatctttcagtgcaacgattc
ccagccattccattgtctcagagctctggtatcctaggctgggtctcgaacagtgacact
ctacacgcattgatcaaagaataccgtgagagccgccgaattctcctgaacattgaacac
cgcatcatgttgcagatggcgccagattatgacaaccttactctcatgcagaaagtggaa
gtctttggatatgctatggataacaccacaggaaaagatctgtaccgggtcttgtggctt
aagagtaaaagctcagaagcgtggctggagcgacgaacaaactacactcggtcccttggt
gttatgtcaatggtgggttacattcttggtctgggtgatcgtcacccgtccaatcttctt
ttggaccgaattactggaagagtggttcacattgattttggtgactgcttcgaagttgca
atgcatcgggagaaatatcccgaaagagttccgttccggttgactcgtatgttgaccttt
gccatggaagtcagcaacattgaaggaagctaccggatcacgtgtgaggctgtcatgcgt
gtcttgagagagaacaaagactctctgatggctgttctggaagcttttattcatgatcct
ttgatcaactggcgcctaggaatccgtgagtcaccagacaggatgccattctcatcagag
cgccggcaatcgattattggtaatatcaactctgaacagggtgtccaacccagcaacttc
tcccgtcaccgacggccatctattcttgaaggtggcattcttgatgctcaggaaggcata
cctaatgaagcccgtgaagcacagaacgcacgcgccctacaagtgctggcgagggtcaag
gagaagctaacgggccgagatttcaagcccagtgaggagctcaatgtcagtgatcaggtt
gacaaactccttgcgcaggcaactagcgttgaaaatatttgtcagcactggattggatgg
tgcagtttctggtga

DBGET integrated database retrieval system