KEGG   Aspergillus flavus: AFLA_045290Help
Entry
AFLA_045290       CDS       T01090                                 

Definition
extracellular endoglucanase/cellulase, putative
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
afv  Aspergillus flavus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afv00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 490 aa AA seqDB search
MRIGNLIVAASAASLVHAYPTRDIKKRGSGFTWVGVSESGAEFGSSIPGTLGTDYTWPDT
SKIQVLRDDGMNVFRIPFLMERLAPNQMTGSLDATYLKDLKSTVQAVTDSGAYAVLDPHN
YGRYSGSIISSTSDFKTFWKTVAGEFASNEKVIFDTNNEYHDMEQSLVLSLNQAAIDGIR
AAGATTQYIFVEGNSYSGAWKWADTNDNLSQLTDPQDKIVYEMHQYLDSDGSGTSETCAS
STIGKERLQTATEWLKTNNKKGFLGEFAGGVNEQCEQAVEGLLSYMSDNSDVWMGAEWWS
AGPWWGSYMYSMEPTDGTAYSTYLPILKKYFVDGTGASTSSSATSAAPSTAAASTSTSVS
ASTSSASSTTISAVESSSTSSVAEAPSTTSGVVTATPTPSHPAPQPTSNSSSASSGAPTS
SAPTTLATSPACGYQTTVTVTASRSTAAPSSSAGAVAHYYQCGGINYSGPTTCESGYTCV
KQNPYYSQCL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcaacttgatcgtggctgcaagtgctgcaagcctggtgcatgcgtatccc
acgcgtgatatcaaaaagcgtggctcgggattcacctgggtcggcgttagcgaatctggc
gctgagttcggatccagcatcccaggaacactgggcaccgactacacttggcctgataca
tctaagattcaggttctgagggatgatggaatgaacgtcttccgtattcccttcctcatg
gagcgtttggcacccaaccagatgactggatctctggacgcgacctatttgaaggacctg
aaatctactgtccaagccgtcactgatagcggtgcttacgccgttctcgacccccacaac
tacggacgatactctggaagtatcatttcttctacttctgactttaaaacattctggaag
accgtcgctggagaatttgcatcgaacgagaaggtcatcttcgatactaacaacgagtac
cacgatatggaacagtctctcgtccttagcctaaaccaggccgccattgacggcattcgc
gcggctggagccacgacccaatacatttttgttgagggcaattcgtactcgggtgcttgg
aagtgggccgataccaacgacaacctcagtcaattgactgacccgcaagacaagattgtc
tacgagatgcaccagtatctcgattcggatggctctggtacctccgagacctgtgccagc
tcaaccatcggcaaggagaggctgcagaccgccacggagtggttgaagaccaacaacaag
aagggtttcctgggtgaattcgccggcggtgtcaacgagcagtgcgagcaggctgtcgag
ggtctcctctcttacatgtcagacaactccgacgtctggatgggtgccgaatggtggtcg
gctggcccctggtggggttcctacatgtacagcatggagccgactgacggaactgcttac
tctacatacctccctatcctgaagaaatacttcgtggacggcactggcgctagcaccagc
tcatcggccacttccgcagccccctcaactgcagctgccagcacctctacctctgtcagt
gcctcgacttcctctgcatcctcgactaccatcagtgctgtcgagtcctcctccactagt
agtgttgccgaagccccctcaaccacctcgggagttgtcactgccacgcctaccccatct
cacccagcccctcagccaacctccaactcgtccagcgcttcatcaggtgcgcccacaagc
agcgccccgacgactcttgcgacttccccggcctgtggataccaaaccactgtcactgtg
accgccagcagatcaaccgcagcacccagcagctccgcaggcgccgtcgcccactactac
cagtgcggtggaatcaactacagcggacccaccacctgcgagagcggctacacctgcgtc
aagcagaacccctactacagccagtgcctgtaa

DBGET integrated database retrieval system