KEGG   Aspergillus flavus: AFLA_046100Help
Entry
AFLA_046100       CDS       T01090                                 

Definition
dihydrofolate reductase, putative
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
afv  Aspergillus flavus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AFLA_046100
   00670 One carbon pool by folate
    AFLA_046100
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AFLA_046100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 248 aa AA seqDB search
MPPTNPLTLIVATTPIPTREKTLLGIGLNGTLPWPRIKADMSFFARVTTRPPRPGTTNAM
IMGRKTYDSVPKSLRPLGKRINVIVTRDVEGVSKRVAEELKEKRAKMAAAAAAATSAGEN
KEEGPITDAIVSSGLEAALEDVEEKFKGGLGSVFVIGGAEIYATALGLGGDRPVRIVMTN
VEKKGVDGEKAVFECDTFFPIDEELLMEKGWRKVSAEEVTEWVGEPVSGEWKDEGEVRIQ
MVGYERVN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaacaaaccctctcaccctaatagtcgcaacgacaccgattcccacgcgcgaa
aaaaccctcctcggaatcggtctaaacggcacactcccctggccgcgcataaaagccgac
atgagcttcttcgcgcgcgtgacaacccgccccccgcgcccggggacaacaaacgccatg
atcatgggtcggaagacgtacgattccgtgcctaagagtctacggccgctgggaaagagg
attaatgttatcgtaacgcgggatgtggagggtgtgagtaaacgggttgcggaggagttg
aaggaaaagagggcgaagatggctgctgctgcggcggcggctacttctgctggggagaat
aaggaggaggggccgattacggatgcgattgttagttctgggctggaggcggcgcttgag
gatgtggaggagaagtttaagggggggttggggagtgtttttgtgattgggggtgcggag
atttatgcgacagctttggggttgggaggggatcggccggttaggattgttatgacgaat
gttgagaagaagggagtggatggggagaaggctgtgtttgagtgtgatactttctttccc
attgacgaggagctgctcatggagaagggatggaggaaggtgagtgcggaggaagtgacc
gagtgggtgggtgagcctgtctcgggggaatggaaagatgaaggcgaggttaggatccag
atggttggttatgaacgggtcaattga

DBGET integrated database retrieval system