KEGG   Aspergillus flavus: AFLA_046410Help
Entry
AFLA_046410       CDS       T01090                                 

Definition
20S cyclosome subunit (BimA/Nuc2/Cdc27), putative
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
afv  Aspergillus flavus
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:afv04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:afv04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:afv04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 649 aa AA seqDB search
MWDAFLGLCETGVNIRVPNIYKMSSELLSVLSSSQEDIDIPPDKVAPAGGPLQTSANVNP
SLDPFMSAASRSDSGTTHGSSALWEKLNGSTVSVASNGTSTPAVREGTETPGGQSSESDD
FRLANGVGDTSWEPPLAPARKNRTIQSIGADHAMDPPPKMKPTGIRQRTRMRVEQEEQTT
TQVEKESVTGSRVGDRKRTVSGQVAHPPAPTEPGAPQRRSVRLFNQIKPTTSKLSGTALG
TKDGRELKKVKATGAKGRATAATGVGRVVSGNRKHVGEIHESDGKEHRPVSTVHSGATNV
ASKAATIEKSKSIEALTWLLELFSKLASGYFALSRYRCTDSIQIFNALSQGQRETPWVLS
QIGRAYYEQAMYSDAEKYFVRVRNIAPSRLDDMEIYSTVLWHLKNDIELAYLAHELMEVD
RLSPQAWCAIGNSFSHQRDHDQALKCFKRATQLDSHFAYGFTLQGHEYVANEEYDKALDA
YRHGISADSRHYNAWYGLGTVYDKMGKLDFAEQHFRNAASINPTNAVLICCIGLVLEKMN
NPKAALIQYGRACSLAPHSVLARFRKARALMKLQELKLALAELKILKDMAPDEANVHYLL
GKLYKMLHDKANAIKHFTTALNLDPKAAQYIKDAMESLDDEEEDDEDMA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtgggatgcatttctgggtttgtgcgagacaggtgtcaatattcgggtccctaatatt
tacaaaatgagctccgaactactttccgttctatcgtcatcacaggaagatattgatatt
ccccctgacaaggttgcgcctgcaggtggaccgctgcaaacttcagcaaatgtgaatcca
agcttggacccctttatgtctgccgcatcccgcagtgactcgggcactacccatggaagc
tctgccttatgggagaaactgaacggaagcactgtcagcgtggcatcgaatggaacatca
acaccagctgttcgggaaggaacagaaacccctggtggccagagcagtgagtctgatgac
ttccgcctggctaacggggttggggatacctcgtgggaacctcccttagctccagccaga
aaaaatcgcacgattcaatcgatcggggcagatcatgcaatggatcccccgccgaaaatg
aagcctacgggtatcagacaaagaacgagaatgagggttgaacaagaggaacaaacgaca
acccaagtggaaaaggaatctgtgacaggatctagagttggcgaccgcaagcgaacggtt
tccggccaggtagctcatccaccagcaccaacagaaccaggagcccctcaacgccgcagc
gtacgtcttttcaaccagattaagcctacaactagcaagctctcaggcacggcattaggc
acaaaggacggcagggaactcaaaaaggtaaaagctactggtgccaaggggcgtgctacg
gcagccacgggtgtaggtcgtgttgtgagcggtaacaggaaacatgtcggcgagatacac
gagagcgatgggaaagaacatcgtccggtatcaactgttcatagtggggctaccaatgtt
gcctctaaggccgcgacgattgaaaagtcgaagtccattgaagctctgacatggctgttg
gagctcttctccaaactggcgtcgggatactttgctttgagtcgttatcggtgtacggat
tctatacaaatattcaatgcgctatctcagggtcagcgagagacgccttgggttctttcg
caaatcgggcgagcgtactacgagcaagcaatgtattcagacgccgagaagtatttcgta
cgggtgagaaacatagcaccgtccaggttggatgacatggagatttactcgactgttctt
tggcatctgaaaaacgacatcgaactagcctatttggcgcatgagctaatggaggtcgac
cgtttatccccccaggcatggtgcgccattggcaattccttctcgcaccaacgcgatcac
gaccaggccttaaagtgtttcaagcgagcgacacaattagattctcattttgcctatggt
tttaccttgcagggacacgaatatgtagcaaacgaagaatacgataaagcactggatgcc
taccggcatggcatcagtgctgatagccgccactacaatgcgtggtacggattgggcacc
gtttatgacaaaatgggcaaactcgactttgctgaacaacatttccgtaacgcagcaagt
attaaccctacaaatgcggtgctcatctgttgtattggtctggtcctggaaaagatgaac
aatccaaaggcagctctaattcaatatgggcgagcctgttcattggcaccacattccgtc
cttgctaggttccgcaaggctcgcgcattaatgaagctgcaagagctcaaattggctcta
gcagaattgaagattcttaaagacatggccccagacgaagcaaacgtgcattatctcttg
ggtaagctttacaaaatgctgcatgacaaggccaatgctatcaagcatttcaccacggcc
ttgaatttagatcccaaggcggcacaatacataaaggacgctatggaatcattagatgac
gaagaggaggacgatgaagatatggcttga

DBGET integrated database retrieval system