KEGG   Aspergillus flavus: AFLA_047030Help
Entry
AFLA_047030       CDS       T01090                                 

Definition
(RefSeq) NADPH-cytochrome P450 reductase (CprA), putative
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AFLA_047030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 NAD_binding_1 NAD_binding_6 DUF4119
Motif
Other DBs
NCBI-GeneID: 7914688
NCBI-ProteinID: XP_002378165
UniProt: B8NBX8
AA seq 483 aa AA seqDB search
MPVGKADDAEGATQEDFMTWKESLFAVLKGLGFQEHEVQYMPTLSVQEDESLEPIDLHNG
EPDGGSLKAQCSPIRPLAISASRELFNSSDRHCLHIDLDLTSQPEFTYKTGDHLAIWPGN
PDSEVERLLQALGLSSRRDVPITIKSLDSATKVKIPSPTTVATVFRYYLEICGPVNRDNV
LGLAQFAPTPDAKAYLQQLGQDKASYAAFINKNHVNLGRLLQQASTETWNIPLSYLVETL
PLMQPRYYSISSSSVISPRKASITVVVSTTPVPENGDELIHGVTSNYLLAVSENLRSAPH
PEGLTYHLNGPSDSLQGGKVLSHLRKSKFKLPTLAKCPLIMVAAGTGLAPFRAFIAERRQ
LQQIGREVGEMLLIFGCRRHDEDFIYRDELEEMTSVLGEKLRIVTAYSREDKKQYVQDKI
SEVGDDVYRLIDEGANFYICGKAEMAREVEKAVAGVMSQKGQDEANEWRTRMKRRNKWQE
DVW
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcggaaaggccgatgatgccgaaggtgctacccaggaagacttcatgacctgg
aaggagagcctatttgccgtactgaagggcctgggattccaggaacatgaggtccagtac
atgcccaccttatctgtacaagaggacgaatccctggagccaattgacttgcataatgga
gagccggatggaggctccctcaaggctcagtgctcgcccattcggcctttggccatctcc
gcttctcgggagctgttcaactcatccgaccgacactgtcttcacatcgatttggatctc
accagccaaccggagttcacatacaagaccggtgatcatcttgccatctggcctggaaac
cctgactccgaggtggagcgtctccttcaagccctgggtctctcatcgcgtcgcgacgtg
cctatcactattaagtcgcttgactccgctacaaaagtgaagattccttccccaaccact
gtcgcaactgtcttccgttactacctcgaaatctgtggtcccgtgaatcgagacaatgtc
ttgggactggcacagttcgccccgacccccgatgcaaaagcatatctccagcaactcggt
caagataaggctagttatgctgcatttatcaacaagaaccatgtcaacctcggtcgactg
ctgcaacaagctagcactgagacgtggaacatccccctatcatacctcgttgaaactctc
cctctcatgcaaccacgatactactctatctcatccagcagtgtaatctccccgcgcaag
gcctcaatcacagtcgtcgtctcgaccacccctgttcccgagaacggagacgaactgatc
cacggcgttacgtccaactacctcctcgctgtctcggagaacctccgctctgctcctcac
ccagaaggactcacatatcatctcaacggacctagtgattccctacaaggcggaaaggtg
ctctcgcacctgcgtaagagcaaattcaagctccccactctggccaagtgcccacttatc
atggttgcggcaggcacaggtctggcgccattccgggcgttcatcgccgagcgtcgacag
ctccagcagatcggaagggaggttggcgagatgctgcttatcttcggatgtcggagacac
gatgaggacttcatctaccgggatgagctggaagagatgacgagtgtgctaggagagaag
ctgcgcatcgtcactgcgtactcgcgtgaggataaaaagcaatacgttcaggataagatc
tcagaggttggcgacgatgtttaccgactgattgatgaaggagccaacttctatatctgt
ggaaaggcggagatggcaagggaggtcgagaaggcggtggcgggggtaatgagccagaag
ggtcaggatgaggcgaatgagtggaggacaagaatgaagagaaggaacaagtggcaggag
gatgtgtggtag

DBGET integrated database retrieval system