KEGG   Aspergillus flavus: AFLA_047280Help
Entry
AFLA_047280       CDS       T01090                                 

Definition
glutamate 5-kinase, putative
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
afv  Aspergillus flavus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AFLA_047280
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AFLA_047280
Enzymes [BR:afv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AFLA_047280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 418 aa AA seqDB search
MHIFQRISTHPFPTGTSSIVDESTHEPILSILTLIVEAAAKLRRDGHNVVLVSSGAVGVG
LRRMDVEERPKNLPRIQALAAVGQCRLMSLWDGLFSHLRLPVAQILLTRNDIADRTQYVN
AQNTFSQLFDMGVIPIVNENDTIAVSEIKFGDNDTLSAITAAMVKADYLFLMTDVDCLYT
ANPRHNPNARPIEVVSDISSLEADVSSAGSSLGTGGMSTKIVAAKLGTSAGVTTIITKSS
KPGNVHEIVKYLQQVKQEEHTHTTTTMNGTVTEAPPLHTRFLPSDHPVQSRTFWLLHGLK
PHGTIFIDHGAYSALQKKASLLPAGVVGVDGHFAQQEAVRLVVVQRLSPDSLNGDFLHHG
QEPKEVGRALVNYGSLEIERIKGHRSTQIQTLLGYADSEYVALRENISFFQQDDPSWR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcacatatttcaaagaatatcaactcatccttttccaacagggactagttccatagta
gatgaaagcacccatgagccgatactttcgattctcactctgatagttgaagccgccgcc
aagcttcgccgggacggccataatgtcgttcttgtttcctcgggggctgttggtgtgggg
ttgcggaggatggatgtggaagaaaggcccaagaatttgcctcgcattcaggcactcgcg
gctgttggacaatgcagactcatgagtctctgggatggtttattttcacaccttcgttta
ccagtggctcagattctcttgactaggaacgacatagcagatagaacgcaatatgtcaac
gcccaaaatactttttcacagctttttgatatgggcgtgatccctattgtcaatgaaaac
gatactatagccgtttcggaaatcaaatttggtgataacgatacactgtcggccataaca
gccgccatggtcaaggccgactacctttttctgatgacggatgttgactgcctttatact
gctaatccacgccacaacccaaatgcaagacccatcgaagttgtctcagatatatcctcg
ttggaagccgatgtgtcctcagctggatcctcccttgggactgggggtatgagcaccaaa
attgttgctgcaaaattaggaactagcgctggcgtaacgacgattatcaccaagagctcg
aaacctggaaacgttcatgagattgtaaaatatctccagcaggttaagcaagaagaacat
acccatacaaccacaacaatgaatggaacagtcactgaagcaccccctctgcatacacgc
ttcctcccttctgaccatccggttcaatccaggacattctggctgctccacggtctgaag
ccccatggaaccatattcattgaccacggcgcatacagtgccctccagaagaaagccagt
ctcctaccagcgggtgttgtcggtgtggatggtcattttgcgcaacaggaggcagtacgt
ctagttgtagtacagagactctcccctgattcattgaatggcgattttctccaccacggc
caggagcctaaagaggttgggcgtgcattggtcaactacggcagcctcgaaatcgagcgc
atcaaagggcacaggagtactcaaattcagactttgcttggatacgcagatagtgaatat
gtcgctcttcgagaaaatatctccttctttcaacaggacgatccttcatggcggtag

DBGET integrated database retrieval system