KEGG   Aspergillus flavus: AFLA_048620Help
Entry
AFLA_048620       CDS       T01090                                 

Definition
histone acetyltransferase, putative
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AFLA_048620
Transfer RNA biogenesis [BR:afv03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    AFLA_048620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 575 aa AA seqDB search
MATATMTMPPPSKSKTNAKLPPENERYMRACSDIANVLIREYEAETDPKKPKKDLNLNRL
RNQIAKKHSLAHLPPLTAIIAAVPEHYKKYILPKLIAKPIRTSSGIAVVAVMSKPHRCPH
IAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIKSLGHS
VDKVEYIIMGGTFMSLPEDYRESFIAQLHNALSGYQTDNVDEAVQAGEMSNVKCVGITIE
TRPDYCLDTHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFKLAKDAGFKV
VSHMMPDLPNVGMERDLFQFQEYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYKNYT
PNALVDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRDV
RTREVGINEVKNKIRPSQVELIRRDYTANGGWETFLAYEDPKQDILIGLLRLRKCSPTHT
FRPEFTGQQTSIVRELHVYGSAVPLHGRDPRKFQHRGFGTLLMEEAERIAREEHGSQKIS
VISGVGVRSYYARLGYTLDGPYMSKMLDPIEDEEL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggccacaatgactatgccgccaccctccaaatctaagacaaacgcaaagctt
cctccagagaatgaacgttacatgcgagcttgctctgatattgctaacgtccttattcga
gaatatgaagctgaaacggatcccaaaaagccaaagaaagatcttaatctgaacagactg
cgcaaccaaatcgcgaaaaagcacagtttggcccatctgccgcccttgacggccattatt
gctgctgtcccggaacattacaagaaatacatccttcccaaactaatcgctaagccgatt
agaacgtcttcgggtatcgccgttgtagccgtgatgagcaaaccccaccgttgtcctcat
atcgcatacaccggtaatatttgcgtctactgccctggtggacccgactccgatttcgag
tactcaactcagtcctataccgggtatgagcccacgtcgatgcgtgctatcagagcacgt
tatgacccgttcgagcaagccagaggacgtgtggatcaaattaaatctcttggtcacagt
gtcgacaaagtagaatatattattatgggtggaacgttcatgtctctacccgaggattat
cgcgaatcgttcatcgcccagctccacaatgcgttgagtggatatcagaccgacaacgtc
gacgaagccgtccaggccggtgagatgagcaatgtgaagtgtgttggtattacgattgag
actcggcctgactattgcctggatacacatttgagcagcatgcttaggtatggatgtaca
cgattggagattggcgtgcaaagtttgtacgaagatgttgccagagacacaaatcgaggc
cacaccgttgctgcagttgcagaaaccttcaagcttgcaaaggatgccgggtttaaggtg
gtcagccacatgatgcccgacttgccgaacgttgggatggaacgtgacctattccaattc
caggaatacttcgagaaccctgcttttcgaaccgacggtctcaaaatatacccaacttta
gtgatccgaggcactggcctctatgaactatggaggactggtcgttataagaactatact
cccaatgccttggttgaccttgtggctcgtattcttgccctagtccctccttggacccgt
atctaccgtgtccaacgagatattccgatgccgctggttacttcaggtgtagagaatggc
aacctgcgtgaacttgctttagccaggatgaaggactttggcaccacatgtcgggacgtc
cgtacccgtgaagtcggcattaatgaagtcaagaacaagattcgtccatcccaggtcgaa
cttattcgacgcgactacacagccaatggaggttgggagaccttccttgcctacgaggat
cccaagcaagacattctaatcggcttgttgcggttgcgaaagtgcagccctacacacact
tttcgccctgaatttactggccaacaaaccagtatcgtccgtgagctccacgtgtatggc
tctgctgtgccgttgcatgggcgtgatccacgcaagttccagcaccgtggttttggtact
ttgttgatggaggaagcagaacgcatcgcgcgggaggaacacggaagccagaaaatcagt
gtcatctctggtgtgggcgtgcgtagttattacgcgcgtctaggctataccttggatggc
ccttatatgtccaagatgttggaccctatcgaggatgaagagctataa

DBGET integrated database retrieval system