KEGG   Aspergillus flavus: AFLA_049390Help
Entry
AFLA_049390       CDS       T01090                                 

Definition
malate synthase AcuE
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
afv  Aspergillus flavus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:afv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFLA_049390
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFLA_049390
   00630 Glyoxylate and dicarboxylate metabolism
    AFLA_049390
Enzymes [BR:afv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AFLA_049390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 539 aa AA seqDB search
MSQIDVQLKDVAILGAIPNDARKILTKEACAFLAILHRTFNPTRKALLQRRIDRQAELDK
GHLLDFLPETKHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNADVWTYMADFE
DSSAPTWENMINGQVNLYDAIRRQIDFKQGNKEYKLRTDRTLPTLIARARGWHLDEKHFT
VNGEPISGSLFDFGLYFFHNAKELVARGFGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRGTVLIETISAAFEMDEIIYELREHSSGLNCGRWDYIFSFIKKFRKHPNFVLPDR
SDVTMTVPFMDAYVRLLIKTCHRRGVHAMGGMAAQIPIKDNQAANDKAMESVRADKLREV
RAGHDGTWVAHPALAAIASEVFNKHMPTPNQLFIRREDTHVTANDLLNTNVPGKITEEGI
RKNLNIGLSYMEGWLRGVGCIPINYLMEDAATAEVSRSQLWQWTYHGVTTAEGKKVDKAY
ALRLLKEQADSLAEKGPKGNKYQLAARYFAGQVTGEDYADFLTSLLYNEISSAGQVSKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatcgacgtgcagctcaaggatgtcgccatcctgggcgccatccccaatgac
gcccgcaagatcctcaccaaggaagcttgtgccttcctggcgatcctgcaccgcaccttc
aacccgacccgtaaagctctcctccagcgccgaattgatcgccaggccgagctcgacaag
ggtcatctgctcgacttcctcccagagaccaagcacatccgtgagaatgacgcctggaag
ggtgctcctcccgctcccggtcttgtcgaccgtcgtgttgaaattaccggcccgacggac
cggaagatggtggtgaatgcgctgaatgctgatgtctggacctacatggctgattttgag
gactcgagcgccccgacctgggaaaacatgatcaacggtcaggtcaacctgtatgatgcc
atccgtcgccagatcgacttcaaacagggcaacaaggaatacaagctgcgcaccgaccgc
accctcccaactttgatcgctcgtgcccgtggctggcacctggatgagaagcacttcacc
gtcaacggagagccgatctccggtagtttgttcgacttcggtctctacttcttccacaac
gccaaggaactggtggctcgcgggttcgggccttacttctatcttcctaagatggagtcc
catctggaggccagactgtggaacgacgtcttcaacctggcccaggattacattggcatg
cctcgcggaaccatccgtggtactgtcttgatcgagaccatcagcgctgccttcgagatg
gacgagattatctacgaactccgtgaacacagctccgggctgaactgcggtcgctgggac
tacatcttctccttcatcaagaaattccgcaagcaccccaacttcgtccttcccgatcgt
tcggacgtcaccatgactgtgcccttcatggatgcctatgtgagactgttgatcaagacc
tgccaccgtcgtggtgttcacgctatgggtggtatggccgctcagatccccatcaaggac
aaccaggctgccaacgacaaggccatggagagtgtgcgcgccgacaagctgcgtgaggtt
cgtgctggtcacgacggtacctgggtggctcacccggctctcgccgcgatcgcctccgag
gtattcaacaagcacatgcccacgcccaaccagctcttcatccgccgcgaggacacccat
gttaccgccaatgatctcttgaacaccaacgtgcccggcaagatcaccgaggagggtatc
cggaagaacttgaacatcggtctctcgtacatggaaggctggctccgtggagtcggatgc
attccgatcaactacctgatggaggacgctgccaccgccgaagtgtctcgcagtcaactc
tggcaatggacctaccacggcgtcaccacggccgagggcaagaaggtcgacaaggcatat
gctctgcgtttgctcaaggagcaggccgacagcctggcggagaagggccccaagggcaac
aagtaccagctggcagcccgctacttcgccggtcaggtgacaggcgaggattatgcggat
ttcttgaccagcttgttgtacaacgagatttcgtcagcgggccaggtgtccaagctgtaa

DBGET integrated database retrieval system