KEGG   Aspergillus flavus: AFLA_049390Help
Entry
AFLA_049390       CDS       T01090                                 

Definition
malate synthase AcuE
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
afv  Aspergillus flavus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:afv01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:afv00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:afv00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 539 aa AA seqDB search
MSQIDVQLKDVAILGAIPNDARKILTKEACAFLAILHRTFNPTRKALLQRRIDRQAELDK
GHLLDFLPETKHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNADVWTYMADFE
DSSAPTWENMINGQVNLYDAIRRQIDFKQGNKEYKLRTDRTLPTLIARARGWHLDEKHFT
VNGEPISGSLFDFGLYFFHNAKELVARGFGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRGTVLIETISAAFEMDEIIYELREHSSGLNCGRWDYIFSFIKKFRKHPNFVLPDR
SDVTMTVPFMDAYVRLLIKTCHRRGVHAMGGMAAQIPIKDNQAANDKAMESVRADKLREV
RAGHDGTWVAHPALAAIASEVFNKHMPTPNQLFIRREDTHVTANDLLNTNVPGKITEEGI
RKNLNIGLSYMEGWLRGVGCIPINYLMEDAATAEVSRSQLWQWTYHGVTTAEGKKVDKAY
ALRLLKEQADSLAEKGPKGNKYQLAARYFAGQVTGEDYADFLTSLLYNEISSAGQVSKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatcgacgtgcagctcaaggatgtcgccatcctgggcgccatccccaatgac
gcccgcaagatcctcaccaaggaagcttgtgccttcctggcgatcctgcaccgcaccttc
aacccgacccgtaaagctctcctccagcgccgaattgatcgccaggccgagctcgacaag
ggtcatctgctcgacttcctcccagagaccaagcacatccgtgagaatgacgcctggaag
ggtgctcctcccgctcccggtcttgtcgaccgtcgtgttgaaattaccggcccgacggac
cggaagatggtggtgaatgcgctgaatgctgatgtctggacctacatggctgattttgag
gactcgagcgccccgacctgggaaaacatgatcaacggtcaggtcaacctgtatgatgcc
atccgtcgccagatcgacttcaaacagggcaacaaggaatacaagctgcgcaccgaccgc
accctcccaactttgatcgctcgtgcccgtggctggcacctggatgagaagcacttcacc
gtcaacggagagccgatctccggtagtttgttcgacttcggtctctacttcttccacaac
gccaaggaactggtggctcgcgggttcgggccttacttctatcttcctaagatggagtcc
catctggaggccagactgtggaacgacgtcttcaacctggcccaggattacattggcatg
cctcgcggaaccatccgtggtactgtcttgatcgagaccatcagcgctgccttcgagatg
gacgagattatctacgaactccgtgaacacagctccgggctgaactgcggtcgctgggac
tacatcttctccttcatcaagaaattccgcaagcaccccaacttcgtccttcccgatcgt
tcggacgtcaccatgactgtgcccttcatggatgcctatgtgagactgttgatcaagacc
tgccaccgtcgtggtgttcacgctatgggtggtatggccgctcagatccccatcaaggac
aaccaggctgccaacgacaaggccatggagagtgtgcgcgccgacaagctgcgtgaggtt
cgtgctggtcacgacggtacctgggtggctcacccggctctcgccgcgatcgcctccgag
gtattcaacaagcacatgcccacgcccaaccagctcttcatccgccgcgaggacacccat
gttaccgccaatgatctcttgaacaccaacgtgcccggcaagatcaccgaggagggtatc
cggaagaacttgaacatcggtctctcgtacatggaaggctggctccgtggagtcggatgc
attccgatcaactacctgatggaggacgctgccaccgccgaagtgtctcgcagtcaactc
tggcaatggacctaccacggcgtcaccacggccgagggcaagaaggtcgacaaggcatat
gctctgcgtttgctcaaggagcaggccgacagcctggcggagaagggccccaagggcaac
aagtaccagctggcagcccgctacttcgccggtcaggtgacaggcgaggattatgcggat
ttcttgaccagcttgttgtacaacgagatttcgtcagcgggccaggtgtccaagctgtaa

DBGET integrated database retrieval system