KEGG   Aspergillus flavus: AFLA_050780Help
Entry
AFLA_050780       CDS       T01090                                 

Definition
dfg10 protein, putative
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     AFLA_050780
    1.3.1.94  polyprenol reductase
     AFLA_050780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 346 aa AA seqDB search
MTMDFLPSLVDWALATAHMDAVDVLRAFFLFASCTILSVSLLDSLRSRFVPYGARATVTA
ESDTTPSEPSSSSPLTHILDYLASLKVPHSYFTQFYVVSLLSSVFWALQLMCHGQAFQAI
ATRVHSEHLQRTMSINQIMLCWVLMLAQGVRRLHECFTFSKPSSSQMWFVHWLAGIAFYL
AVSIALWIEGTGMQFPWPSTIAVPLISIGSKFTETLLSHKLSLDDVTVNNAPSLRTFLCL
PIFLFASGLQHDAHHYLFSLKKYTLPSHPLFRSIVCPHYTAECAIYLSLALLAAPRGEMI
NKTVLSAAVFVTVNLGVTASETKRWYMQKFGESSVRERWNMIPWVY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggactttcttcccagtctcgtcgactgggcactggcgactgcccacatggac
gcggtggatgtccttcgagctttctttctctttgcatcgtgtacgatcctgtcggtcagc
ctgttggattcccttcgttcgcgcttcgtcccttatggcgctcgtgcaaccgtgacggcc
gagtcggatactaccccgtctgagccttcgagcagctcccccttaactcacattctcgac
tatcttgcctctttgaaagttccacacagctatttcacacagttctacgtcgtctccctg
ctatcctcggttttctgggcccttcagcttatgtgccatggacaagcgttccaagccatc
gcgacgagggttcactcggaacacctacagaggacgatgtcgatcaaccagattatgttg
tgctgggtactgatgctcgcgcaaggtgtaagacggttacatgagtgcttcaccttttcc
aagccttcttcttcccagatgtggtttgtccactggctagcaggcattgctttctatcta
gcagtctcaatcgccctgtggattgaggggacaggtatgcagttcccgtggccaagcacg
attgctgtcccgctaatttcgatcggttcgaaattcacagaaacgctgttgtcccataaa
ttgagcctcgacgatgtaaccgtgaacaacgccccaagccttcgtacatttctctgcttg
ccaatctttctgtttgcatctggcctacaacatgacgcccaccactatcttttctctctc
aagaagtacacccttccctcccaccccttgttccgcagcatcgtatgtccgcactacacg
gctgaatgtgcgatctacctatcattggccctgcttgccgctccccggggagagatgatc
aataagacagttttgtccgctgccgtctttgtcacggtcaatttaggcgtcactgcgtcc
gagaccaaacgctggtacatgcagaaattcggcgagagctcggtgcgggagaggtggaat
atgatcccttgggtatactaa

DBGET integrated database retrieval system