KEGG   Aspergillus flavus: AFLA_051420Help
Entry
AFLA_051420       CDS       T01090                                 

Definition
histone acetyltransferase (Gcn5), putative
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
afv  Aspergillus flavus
Brite
Enzymes [BR:afv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AFLA_051420
Transcription machinery [BR:afv03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     AFLA_051420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 402 aa AA seqDB search
MASENNKRKASEEALSPDSQLQSKKARTDSPEREPKSEGGPLGKPPLRIVPFPEKPAVLE
ERRGEIEFRVVNNDGSRDSFVVLTGLKCIFQKQLPKMPKDYIARLVYDRSHLSIAIVKHP
LEVVGGITYRPFNSRRFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSPIMHFLTYAD
NYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTIMQCTMLPKIRYLEIGRMLLKQKEAV
HAKIRAFSRSHIIHAPPKEWKNGACKIDPLSIPAIKQSGWSPDMDELARQPRHGPNYNQL
LHLLNDMQNHSAAWPFTQPVNRDEVPDYYEVIKEPMDLSTMEEKHEKDMYPTPQDFIKDA
MLIFDNCRRYNNENTPYAKSANKLEKFMWQQIRNIPEWSVST
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagaaaacaacaaacggaaagcttcggaggaagccctttccccagattcacag
ctacagagtaagaaagcgcgcaccgattccccagagagggaaccaaagtctgaaggtgga
ccattgggaaagccaccattgaggattgttcctttcccggagaagccagccgtactagaa
gaacgtcgaggggagatcgaattccgggtcgttaataatgatggttcgcgcgacagcttt
gttgtcctcactggactgaagtgcatctttcagaagcagctcccgaagatgcccaaagat
tacattgctcgattggtctatgatagatcgcatttatctatcgccattgtcaaacatcca
ctggaagtagtaggaggaattacatacaggccttttaacagtcgcagatttgcggagatt
gtcttttgtgccatatcctctgatcaacaggtgaagggttatggtgcgcatttgatgtct
cacctgaaggattatgtgaaggcaacgtcgcctatcatgcatttcctgacatatgcggat
aactatgctattgggtatttcaagaagcaagggttcaccaaggaaattacactggataag
tctatctggatgggttatattaaggattatgaagggggcaccattatgcaatgtacgatg
cttccaaaaatacggtatcttgaaattggccgtatgcttctaaagcagaaagaagcagta
cacgccaagatccgtgccttcagccggtcacatatcatacacgccccgccaaaggaatgg
aaaaatggagcgtgtaaaatcgatccgttaagtatcccggcaatcaagcaatctggatgg
tcacccgacatggatgagttagcgcgtcaaccacgccatggaccgaattacaatcaacta
ctacatctgctgaacgatatgcaaaaccatagtgcagcctggccttttacgcagccggtc
aatcgtgacgaggttcctgattattacgaagtgatcaaggagccaatggatctgtcgacc
atggaggaaaaacatgagaaggacatgtatccaacaccacaagatttcatcaaagatgct
atgttgatcttcgacaattgtcgaagatacaacaacgagaacacgccttatgcaaaaagt
gcgaataaattggagaagtttatgtggcagcaaattcgaaatattcccgagtggtcggta
agtacatga

DBGET integrated database retrieval system