KEGG   Aspergillus flavus: AFLA_051480Help
Entry
AFLA_051480       CDS       T01090                                 

Definition
ubiquitin C-terminal hydrolase CreB
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
afv  Aspergillus flavus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 755 aa AA seqDB search
MGSFLRSLRRDVGPPTPSVGATPAKKEPPVPPVTPLEKMLQDMGAIREDGSDKFFGMENY
GNTCYCNSILQCLYYSVPFREAVVNYPTRTPIESLEAALANTLRYQNFAANLEAEALAEK
QKAANAQRPGAPPNQPQKPEDKDSPEYKKKMALQTLPLLETKNNATSYGMSESLFTSLKD
LFESVVASQSRIGIIRPQHFLDVLRREHEMFRTAMHQDAHEFLNLLLNEVVANVEAEASK
QPEPERSLPPAESADSTELSGSSGSKTPNTTRWVHELFEGTLTSETQCLTCEKVSQRDEV
FLDLSVDLEQHSSVTSCLRKFSAEEMLCERNKFHCDNCGGLQEAEKRMKIKRLPRILALH
LKRFKYTEDLQRLQKLFHRVVYPYHLRLFNTTDDAEDPDRLYELYAVVVHIGGGPYHGHY
VAIIKTQDRGWLLFDDEMVEPVDKNYVRNFFGDRPGLACAYVLFYQETTLEAVMKEQEQE
NMDLNTSVADINDSTLKQNGYPLSPGLAHVHSASQIPSPSEPARFSNLQRAPTAPPLFPH
PEHADSESSPADPSTTASATPPVPPIPDIHSLPLSPKKSDSHFKKERAKEEKERKANEKE
KEKQRRRDQEARIREQRREDAEIRAALEASKASKAEEDRRHSPDDTKKSSHGLSRLKRGS
KSFSHRLGKDKENRVSSSSHSATPIAEHPPSRNGASESQQQLPNGQSPGSHGLHTRHTGL
DEERDTLKDPKHDRSGHHGKWRSFSLKKKSFSILS
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgtttctaaggagtctacgcagagatgtgggacctcccacaccctcagttggg
gcgactcccgcaaagaaagaaccaccagtgcccccggtgacccctttagaaaagatgctc
caggatatgggtgcgatccgcgaggatggtagtgacaagttttttgggatggagaattac
ggtaatacctgttattgtaattcgatcctacagtgtctatattattccgttccttttcga
gaggctgtcgttaattacccgacccgaactcctatagagagtctggaagcggcgctggca
aatactcttcgctatcaaaacttcgccgccaacttggaagccgaggcgctggccgagaaa
cagaaagctgccaatgcccagcgtcctggcgcgcctccgaatcaaccgcaaaaaccagag
gacaaagactcgcctgaatataagaagaagatggcattacagacgctgcccctcttggag
actaagaacaacgcgaccagctatggaatgtcagagtccctcttcacgtcgttgaaagac
ttattcgagtctgttgtcgcaagccagtcacggataggtataatccgaccacagcacttt
ttggatgttctccgacgcgaacacgaaatgtttcggactgccatgcatcaagatgcccat
gaattcctaaacctacttctcaacgaagttgttgcgaacgtggaggcagaggcatctaaa
caacctgaaccagagagaagtcttcctccagctgaaagcgcagactcgactgagctatcg
ggaagttcaggctctaaaacacccaacactactcgctgggtacatgaattatttgaaggg
actttgacctcggaaacacagtgtttaacttgcgagaaggtttcgcaacgtgacgaagtt
ttcttggacttgtcggtagatcttgaacagcactcgtcggttacgtcgtgtttgaggaag
ttctcagcggaggagatgctttgcgaaagaaacaagttccactgtgataactgcggtggt
cttcaagaggcggaaaagaggatgaaaatcaagcgcctgcctcggattctggccctgcac
ctcaaacgattcaaatataccgaagacctgcaacgacttcaaaagctgttccatagggtt
gtatatccctatcaccttcgccttttcaatacgacagacgatgcggaggacccggatcgt
ttatacgagctgtatgcagtggtggtgcatatcggtggcgggccatatcatggacactat
gtcgccattattaaaacacaagatcgcggatggttgctgtttgacgatgagatggtagag
cctgtggacaagaactatgtccgtaatttctttggtgacaggccaggcctcgcctgcgcc
tacgtcctattctatcaggagaccacacttgaggctgttatgaaagaacaagagcaagaa
aacatggacctaaacacgagcgtcgccgatatcaacgactcaaccttaaaacagaatggc
tatcctctatctccagggttggcccatgttcacagcgcatctcagataccatcacccagt
gaaccagcccgattcagcaatctccaacgggcccctactgcacctcctttattccctcac
ccggaacatgcagactctgaaagttcccccgcagatccttcgactactgcatctgccacc
cctcctgttccaccaataccggacattcattctctccctctcagccccaagaagagcgac
tctcatttcaaaaaggaacgggccaaagaggaaaaggagcgaaaagcaaacgagaaagaa
aaagagaaacagcgccggagggatcaggaagcgagaatcagagaacagcgacgagaggat
gctgaaatccgagctgcgctcgaggcgagcaaggcgtccaaggccgaggaagatcgtcga
cattcccccgatgacaccaagaagtcaagccatggcttgagccgtctgaagcgcggtagc
aagagcttcagccatcggctcggcaaagataaagagaatcgagtttcttcatccagtcac
tcagcaacacctattgcggaacacccaccatcaagaaacggggcctccgaatcacagcaa
caactacctaacggccaatctccaggttctcatggcttacatactagacatacaggactg
gatgaagagcgggatacactcaaagatcccaaacacgacagaagcggacatcatggaaaa
tggaggagtttcagtctcaagaagaagtcatttagcattctttcatga

DBGET integrated database retrieval system