KEGG   Aspergillus flavus: AFLA_052570Help
Entry
AFLA_052570       CDS       T01090                                 

Definition
MAP kinase MpkA
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
afv  Aspergillus flavus
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:afv04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MADLRGRKIFKVFNQDFIVDERYNVTKELGQGAYGIVCAATNIQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKIPFQRLFPSANPDALDLLDRMLAFDPS
SRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVDDVQEMRRMIYEEVVRFRAAVRQ
QSQAQAAAAAQQQQIAQQTNVPIPENQQGVWKQEEPKPQEALAAGGGVHNDLESSLQRGM
DVQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctacgaggacgtaagatcttcaaggtcttcaaccaggattttattgtggat
gaacgatacaatgtcacgaaggagttgggtcaaggtgcatatggtattgtctgtgccgcc
acgaacatccagaccggcgaaggtgtcgccatcaagaaagtcaccaatgtcttcagcaag
aagatcttagccaagcgcgccttaagagaaattaagttgcttcagcatttccgaggccac
cgtaatatcacttgtctgtatgacatggacatcccgcgcccagataacttcaatgaaaca
tatctgtatgaggagttgatggagtgtgatctcgccgctattatccgttccggacaacct
ttgaccgatgcccacttccagtcttttatttatcagattttgtgtggtctgaagtatatc
cactcggccaatgtattgcatagagatttgaaacccggaaacttgctggtcaatgccgat
tgtgaactcaagatttgcgatttcggattggcgcgtggtttctcgattgacccggaagag
aacgcaggttacatgaccgaatatgtcgcgacaagatggtaccgtgctccggaaatcatg
ttgagcttccagagttacactaaagctatcgatgtgtggtccgtgggttgcatcttggct
gaacttcttggcggccgccccttcttcaagggtcgtgactatgtcgaccagctcaaccag
attctgcactacctgggcactccgaacgaggagaccttgagccggatcggctctccacgg
gcccaggagtacgtacgcaacttgcctttcatgcccaagatccccttccagcgcttgttc
cccagtgccaaccctgatgcgcttgacttgctcgaccgcatgctggccttcgacccctcg
tcgcgtatctcggttgaagaggccctggagcacccatacctgcacatctggcacgacgca
tcggacgagccgacgtgccccacaaccttcgatttccacttcgaagtggtggacgacgta
caggagatgcgtcgtatgatctacgaggaagtcgtgcgcttccgtgccgccgtccggcag
cagtcccaggcgcaggccgccgctgccgcccaacagcagcagattgcccagcagaccaac
gtcccgatccccgagaaccagcagggcgtttggaagcaagaggagcccaagcctcaagag
gcgctcgccgcgggcggtggcgtccacaacgatctggaatcgtcgctgcagcgtggaatg
gacgtacaataa

DBGET integrated database retrieval system