KEGG   Aspergillus flavus: AFLA_052620Help
Entry
AFLA_052620       CDS       T01090                                 

Definition
(RefSeq) ubiquitin C-terminal hydrolase, putative
Organism
afv  Aspergillus flavus
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 1304 aa AA seqDB search
MTSFQRSVLTWTTRRPGKTAPRLVQDIYEYDPAHPPATGRNLLADVPPVFPEYYNGPLEH
ISSAACRHNFVSKPAQSYVPQSEQGNTGASTKVSAVCLMCRYHLQVEVSSTPGIGQPSTR
FSDHVHHLVYKSGKHRGGAAPEEVSPKGQMLEMFHYECSYLSCSVAVSLRFASPVLNDDR
VRLLTDPEVLRQRANEAFAAHPDRLEGVAPPTPINVLLNLRTYISNALLDSQQSKSISAV
NKRFMTCFGVEGKPCKDLLEFLGFSSKNEGFWEPPRPNPWAEFPYRDQLKIFLDDVIHEL
TALIEQRPVVEKKGHQLEFIRQPVFNDLLYALGSLDYPKASRSSEFQMAPQPYYEDLGVV
EDMAASSIIEAFNRQVSVDPARTPVYLKCLKSIGILRGGEDGSLIDQAVQVAYSEGKYTE
EDVVDAYKYFGLSHDDQRLTEESIIGKFYAYLGATTTVQETETRRQLWRIGDSRRSERIK
AAAEERVSTAEQARVFLGVSADTPDDFVMAVYTAKVNDNPSSRDLARRAVQLLAEERKSE
ALKHFLKTGEMTAGEMDVADAYRLLQIPDRTVDEGAIMAAYTICVDEAPAQAENYNQALR
IIAKDKNSPLLSNMVSGSTTKPDRNLAEWPVGLQNIGNTCYLNSLLQFYFSIRPYRDMVL
DFEKFKMEINEDMLGQKQVGSRKVSQKEVERSQRFLSELRTLFNDMITAPATYVIPTQEL
ARLTLISPSNEAAIRRRSTLSGIRPSALGEINGVPVMGPLGPPQLTPESEVKGPIAPEPE
KPQRSTTSDVDSEATLVSDGARIDATVPSSNDKEPEPLVTDPTKMDVQDVLTPEAVEYQP
SDKPTSGEQNELSSQPPPVPPRPGPQPDPQKQLIEEVEIGAQQDVTEVINNVLFQSQCAI
KPISLAPDGEQLDQVKDLFYGKAKSYIQTTEGVRSKEEWWCDIKIDVATGSRDIYAAIDG
AFDVQKVSVGNSVAEQFSAISKLPPVLQVQVQRVQFDPVKKRSFKSTHHLELKETIYLDR
YMDTQQPEILNRRRQCWEWKNALRTLEARRAELQRQSEADGLDIPSLFDNAKDVLEELNS
MKEDPEIAADAVPINSELIPELNQLSQIARAELNYIEQEIKDLQTMISSQFADYKHLAYR
LYAVFVHHGSVEFGHYYIYICDFERDIWRKYNDNYVTEVHDLDEIFTSQDRQNPPTPYFL
VYVNATMKDRLVSPLCREILESPPEDQLSGDGGIATEGVTPPTVAEDVDMNPPAYDEIWA
DKGTSGTEDNHHIEDKTGPTGVGGNEVTGRGPSNKDTDFHDVQW
NT seq 3915 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcctttcaacggtcagtactgacatggacaacccgacgaccaggcaagaccgcc
ccccgtcttgtacaagatatatacgaatatgatcctgctcaccctccagcgaccggccgc
aatctgctcgcggacgtcccgccagtgtttcctgaatattacaatggaccgctagaacat
atctcatcggcggcatgccgccataattttgtatcgaaaccagcacagagttatgtccct
cagtcggaacaaggcaacactggagcctctacaaaggtgtcggctgtgtgcttgatgtgc
cgctatcatctgcaagttgaggtgagctctacgcccggtattggtcaacctagcacgaga
ttttcagaccacgtacatcatctggtatataagtccggaaagcacagaggcggcgcagcg
ccggaggaggtcagtcccaagggacagatgctggagatgttccattatgaatgttcatat
ttgtcttgctccgtcgcagtatctttgcggttcgcctcacctgtgcttaatgatgaccgg
gtgcgactgttgacagaccccgaagtgctgcgacagcgggcgaacgaggcatttgcagcc
catcctgaccgtctggaaggagttgctccacccacacctatcaatgtcttgctgaacctg
cgtacatatatcagcaacgctcttcttgatagccaacaaagcaagtcaatctcagcagtt
aataaaagatttatgacgtgtttcggagttgaagggaagccttgcaaagacctgttagaa
ttcctgggatttagctctaagaacgaaggcttttgggaacctcctcgaccgaatccgtgg
gcagagtttccctatcgcgatcaactcaagatatttctcgatgacgttatacacgaactt
acagcgctcatcgaacagaggccagtggtagagaagaagggccaccagctagaatttatt
cgtcaaccggtcttcaacgatcttctctatgcactgggatctttggactacccgaaggcc
tcacgatcaagtgaatttcagatggctcctcaaccttactacgaagacctgggtgttgtc
gaggacatggcggcttcatcaatcatagaggcttttaaccgacaagtctcggtggatcct
gctaggactcctgtctacttaaagtgtctgaagtcaatcgggattctcagaggaggagaa
gatggttctcttatagaccaggcagttcaggtagcctactccgaagggaaatataccgaa
gaggacgtggttgatgcctacaagtactttggcctaagtcacgacgatcagcgactcacg
gaagaaagcatcattgggaaattctatgcttatctaggtgccactactactgttcaggag
actgagacccgcagacaactatggaggataggagatagcaggcggagtgagcggatcaag
gcagcagcggaagaaagggtgtcaactgctgagcaggcccgggttttccttggcgtcagc
gctgatacgcctgatgattttgttatggcagtttacacagctaaagtcaatgacaaccca
tcgagccgggatcttgctcgccgtgcagtccagctgctagcagaagagcgaaaatcggaa
gccttgaaacattttctcaagacaggcgaaatgactgccggtgagatggacgttgctgat
gcctaccgtctccttcagatacccgaccgcaccgtggatgagggagcaatcatggcagca
tacactatctgtgtggatgaagctccagcacaagctgagaactacaatcaggcgttgcgg
attatcgcgaaagataagaatagccctctgctgagcaatatggtttctggttctaccact
aaacctgaccgtaacttggctgaatggccagttggactgcagaatattggcaatacctgc
tacctcaacagtctgttgcaattctatttttcaattcggccataccgtgatatggtcttg
gacttcgagaaattcaaaatggagataaatgaggacatgttgggccaaaaacaggtgggg
tctcgcaaggtttcgcaaaaggaggttgagcggtcccaacgtttccttagcgagttgcga
actcttttcaatgacatgatcactgccccagcaacttacgttattcccacccaggagctg
gcgcggttgacgctgatcagcccgtctaacgaagccgctattcgtcgccggtcgacgctg
tctggaatcagacctagtgctctcggtgaaatcaacggtgtgccagttatgggacctctc
gggcccccacagctgactccggaaagtgaagtcaaggggcccatagctcccgagccagag
aaaccccaacgttcaacgacaagcgatgttgatagcgaggcaactcttgtttctgatggc
gccaggatcgatgccacagtcccgtcttctaatgacaaggaacccgagcctctagttaca
gatcctacaaagatggacgtgcaggacgtgttaacccctgaggcagttgagtaccaacca
tccgacaaaccgacttctggtgagcagaatgagttgtctagccagcctcctccagttcct
ccacggcctggtcctcaacctgacccgcagaagcaacttatagaggaagtagagattgga
gctcagcaggatgtgacagaagtaatcaataatgtcctgttccagagtcaatgtgccatc
aagccaatttcgcttgctccagacggtgagcagctcgatcaggtgaaagacttgttttac
ggcaaagccaagtcctacatccaaacaactgaaggagtgcgatcaaaggaagaatggtgg
tgtgatataaagatcgacgtcgccactggatcacgagatatctatgctgccattgacggt
gcttttgacgtccagaaagttagcgtaggtaattcggtggcggaacagtttagtgcaatc
agcaagctgccgccagttctccaggttcaggtccagcgtgtccagttcgatcctgtcaag
aagcgctccttcaagtccacccaccatttagaattgaaggagactatctaccttgatcgg
tatatggacacccaacaacccgaaattttgaatcgccgtcgtcagtgttgggaatggaaa
aatgcattaagaacgctcgaggctcgtcgagcagagttgcaacgccaaagtgaagctgat
ggcctggacataccgagcttgttcgacaatgccaaggatgttctagaagagctgaactct
atgaaggaggaccccgagatcgcagcagatgcggttcctatcaattcagaacttatacct
gagcttaatcaactttcccagatagcgagggcagagctgaactacattgagcaggagatc
aaggatctacaaactatgatctcaagccagtttgctgactacaaacatttggcctatcgt
ctctatgctgtcttcgttcatcatggctccgttgaattcgggcactactacatttacatc
tgtgatttcgaacgagatatttggcggaaatataacgacaactatgtcactgaagtgcac
gacctggatgaaatattcacgagccaggaccgccaaaatcccccgactccgtacttctta
gtatacgtcaatgcgactatgaaggaccgtctagtcagtcctctttgcagggagatactc
gagtctcccccagaggatcaactgagcggggatggaggaattgctacggagggagttact
ccgccgacggttgcagaagatgtggacatgaacccaccggcatacgatgagatatgggct
gacaaaggcacatcaggtacggaagataaccaccatatagaagataaaacgggccccaca
ggtgtggggggtaatgaggtcactggcagagggccgtcaaacaaagacactgacttccat
gatgtgcaatggtag

DBGET integrated database retrieval system