KEGG   Aspergillus flavus: AFLA_055480Help
Entry
AFLA_055480       CDS       T01090                                 

Definition
calcineurin Ca2+-binding regulatory subunit CnaB
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
afv  Aspergillus flavus
Brite
Protein phosphatases and associated proteins [BR:afv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AFLA_055480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 205 aa AA seqDB search
MEHSSAPNNAALYDARRRRGSVGTSQLLDNIVSASNFDRDEVERLRKRFMKLDKDSSGTI
DRDEFLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKV
YDIDRDGYISNGELFIVLKMMVGNNLKDVQLQQIVDKTIMEADKDQDGKISFEEFTDMVE
NTDVSLSMTLSMYPQFSFSLVSRLW
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggaacattcctccgcacccaataatgccgccctgtacgatgcgcggagacgcagaggc
tcggtcggaacgtcgcaactattagacaacatcgtctccgcttccaacttcgacagagat
gaggttgagcgactccgcaagcgattcatgaaactggataaggacagctcgggtacaatt
gatcgcgatgaattcctttcccttccgcaagtgtcatccaacccgctggcaacgagaatg
atcgcaatcttcgatgaagatggtggcggtgacgtcgacttccaagaattcgtttcaggt
ctctcggccttctcgtctaagggtaacaaggaagaaaagcttcgcttcgcattcaaggtc
tacgatatcgatcgcgacggttacatctctaacggagaactgttcatcgtattaaagatg
atggttggcaacaacctgaaagacgtgcagctgcagcagatcgtcgataagaccatcatg
gaggcggacaaggatcaggatggaaagatcagcttcgaggagtttacggatatggtggag
aatacggatgtcagtttgagtatgacgctaagtatgtatccccagttttccttttccctt
gtcagtaggctttggtga

DBGET integrated database retrieval system