KEGG   Aspergillus flavus: AFLA_055600Help
Entry
AFLA_055600       CDS       T01090                                 

Definition
ARD/ARD family protein, putative
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
afv  Aspergillus flavus
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:afv00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 178 aa AA seqDB search
MKAYWYDNKPGDQREPHDSGRPVSKDYLASLGVFYRYCPDIESVNALAKERGYKNRDEVC
VSPQTMGDVYESKVKMFFAEHLHEDEEIRYIRDGEGYFDVRGQDDEWVRIQLSKDDLIIL
PAGIYHRFTTDEKNYVKAMRLFQEEPKWTPLNRSEDVDTNPHRKTYLGTLSTSAVAAK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcatactggtacgacaacaagccgggtgaccagcgcgagccccatgactctgga
cgtcctgtctccaaagactacctcgcttctctcggagttttctaccgctactgccctgat
atcgagtctgtcaatgctttggccaaggagcgcggatataagaaccgcgatgaggtgtgc
gtttctccacagaccatgggcgatgtgtacgagtcgaaggtgaagatgttctttgctgag
caccttcacgaggatgaggaaatccggtacatccgcgatggtgagggttacttcgatgtg
cgcggtcaggatgatgaatgggtccgtatccagctcagcaaggacgacctaatcatcctt
cctgccggtatctaccaccgattcacaaccgacgagaagaactatgttaaggctatgcgc
ctcttccaggaagaacctaagtggacgcctctgaaccgtagcgaagatgtcgataccaac
ccccaccggaagacatatcttggaactctcagcacaagtgctgtggctgcaaagtaa

DBGET integrated database retrieval system