KEGG   Aspergillus flavus: AFLA_057380Help
Entry
AFLA_057380       CDS       T01090                                 

Definition
cyclin Ccl1, putative
Orthology
K06634  
cyclin H
Organism
afv  Aspergillus flavus
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:afv00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AFLA_057380
  Replication and repair
   03420 Nucleotide excision repair
    AFLA_057380
Transcription machinery [BR:afv03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     AFLA_057380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 422 aa AA seqDB search
MIEDDFYRSSSQFRLWSYTEASLQSLRATTNANASERVRSALRKSREAQQSATSSAAGTP
AANQNGSDADSKAGGEETEIECLTPEEEHQLVRYFCEQIIELGEMYKPPLPTIVRATAIQ
YLRRFYLTNSPMTYHPKSIMLCALFLATKTDNYYLSLRQFAEVIPGGTTPEDIIQPEFLV
MQSLRFTFDVRHPFRGLEGGIMELQAISQGMGQPAPHFPTQTPDDLKRRLHSLPASPTTS
SSSITDRLARAHHNTREILKSAAQMTDAYFLYTPSQIWLAAFMIADKPLAEFYLETKLGG
PQQQQQGSPLYELRVKLLRTLTDCSNLLQAYKPLASDPDQKKNLRRIRKKLTHCQNPDKA
GVAGQKRIPAAAAAVAAAGDPATSESEMERLAKKRKLDGGQPNDIFGGELVTQRTKEAQQ
PQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagacgatttctaccgctcctcatcccagttccgactttggtcctacacagag
gcatctttacaatccctacgcgcaacgacaaacgcaaacgccagtgagcgagtacggtcc
gcactccgaaaatcgcgagaggcgcaacaatcagccacctcatccgcagcgggaacacca
gcagcaaaccagaatggaagcgacgcagacagcaaagcaggcggcgaagagacggagatc
gagtgcctaacacctgaagaagagcaccagctggtgcgatacttctgcgaacagatcata
gagttaggggagatgtacaaacctccactcccaacaatagtccgggccacagcaatccaa
tacctccgacgcttctacctaaccaactccccaatgacctaccacccgaaatcaatcatg
ctctgcgccctcttcctcgccacaaaaacagacaactactacctctccctccgccaattc
gcagaagtaattcccggcggcacaacaccggaagacataatccagcctgagtttctggtc
atgcaaagcctccgcttcacgttcgacgtccggcaccccttccgcggcctcgaaggcggc
atcatggaactccaagccatatctcaaggcatgggccaaccagcaccacacttcccaacc
cagacaccagatgacctcaaacgcagactccattccctccccgcatcaccgacaacatcc
tcatcctccatcacagaccgacttgcccgcgcgcaccacaacacccgcgagatcctcaaa
tccgccgcccaaatgactgacgcttacttcctctacacgccgtcccagatctggctcgct
gcgttcatgatcgcagataagccgctagcggagttctatcttgagactaagctgggcgga
ccccagcagcagcagcagggatccccgctttatgagctccgggtgaagctcctccgtacc
ttgactgattgctctaacctccttcaggcgtacaaacccctcgcctcagatccggaccag
aagaagaacctaagacgcatcaggaagaagctcacccactgccagaacccggacaaggct
ggagtagcgggccagaagcgtatccctgcggcggcggcagcagtagcagcggctggggat
ccggcaacctctgagagcgagatggagcgactggcaaagaagcgcaagttagacggggga
cagccgaatgatatatttggaggtgaattagtgacgcaacggacgaaggaggcgcaacag
cctcaatag

DBGET integrated database retrieval system