KEGG   Aspergillus flavus: AFLA_057420Help
Entry
AFLA_057420       CDS       T01090                                 

Definition
O-methyltransferase, putative
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
afv  Aspergillus flavus
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:afv00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 275 aa AA seqDB search
MSQNQPTTRQRNDEAELDLLDFIYAQPNRDEIQGNPQKVLDLIDEFAKSRHLIHVGPEKG
KVVADLIAERKPQTMIELGGYVGYSAILFGDAVRRAGGKKYYSLELNPEYAAISTLLLDL
AGLRDFVQILVGRSDQSLNKLCASGEVPQVEIMFIDHYKPAYTTDLKLCEQLGMIVPHVS
VLVADNVLYPGNPPYLEYVRSTVEQKRKAAEKGPIQMYNTEGIPAVSVRAFLGSDSTPLF
DILGDPNLVYESTLNQPEGLRDALEITRCVGVEKA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaaaccagcctacaactcgtcagcgcaatgacgaagccgaactcgaccttctc
gacttcatctacgcccagccaaaccgggatgagatccaaggaaacccccagaaagtactg
gatctgattgacgaattcgctaaatcgcgtcacctcatccatgtggggcccgagaaaggg
aaggtcgtagcagacctcatagcggagcgcaagccccagaccatgatcgaactcggaggt
tacgtgggttactcggccatcctgttcggcgatgccgtgcgtcgggccggtggcaaaaag
tactacagtttagagttgaaccctgaatatgccgccatctcgactctgttgctggatctg
gcgggcctccgggattttgtccagatcctggtgggtcgcagcgaccagtccctgaataag
ttgtgtgccagcggcgaagtcccacaggtggaaattatgttcattgatcactataagccc
gcgtatactacggatctgaagctatgcgagcagcttggcatgatcgttccccatgtttcg
gttctggtggctgataacgtgctctatccggggaatccaccgtacctggagtatgtccgg
agcacggtggagcagaaacgaaaggcggctgagaaggggccaatccagatgtataacacg
gagggtatacctgctgtgagtgtgcgggcctttcttggctcggattcgacgcctctgttt
gacatcctcggggacccgaatttggtgtatgagagcaccttgaatcaaccggagggactt
cgggatgcccttgagattactcgatgtgtaggagttgagaaggcgtga

DBGET integrated database retrieval system