KEGG   Aspergillus flavus: AFLA_058090Help
Entry
AFLA_058090       CDS       T01090                                 

Definition
serine/threonine protein phosphatase PP1, putative
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
afv  Aspergillus flavus
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:afv03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:afv04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 326 aa AA seqDB search
MSEKEEVDLDSIINRLLEVRGSRPGKHVRLQDSEIQYLCHKAREVFISQPILLELEAPIQ
ICGDVHGQYYDLLRLFEYGGYPPDANYLFLGDYVDRGKQSVECICLLLAYKIKYPENFFI
LRGNHECASINRIYGFYDECKRRYNVKLWKTFIDCFNCLPIAAIVEDKIFCMHGGLSPDL
NSMEQIRRIMRPTDIPDCGLLCDLLWADPEKEITGWGENDRGVSFTFGPDVVHRFVQKHD
IDLICRAHQCVEDGYEFFAKRKLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAE
KKKAIITRGFKSDRSNPSSSQQKKQS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaggaggaggtagatctggactctatcattaatagattgctcgaagtcagg
ggtagccgaccaggtaaacacgttcgactgcaggactcggagatccaatatctctgtcat
aaagcgcgtgaggttttcatatcccaacccatattactagagctcgaggcacccattcag
atttgcggtgatgtccacggccagtactacgatctccttcgcctgttcgaatacggcggc
tatccacctgatgccaattacctgttccttggcgactatgttgaccgcggaaagcagtcg
gtcgaatgcatttgcctcctgctagcttataagatcaaataccccgagaacttctttatc
ctgcgaggaaatcacgaatgtgcctcgataaaccgaatctatgggttttacgacgaatgc
aagaggagatataatgtcaagctctggaagacgtttattgattgctttaactgtttgcca
attgcggctattgtggaggacaagatcttttgtatgcatggaggacttagtccagattta
aattccatggagcagatccgtcgcataatgcgtcccacagatatacctgactgcggtcta
ttgtgtgatctcctctgggcggatccggagaaggaaataactggctggggcgagaatgac
cgtggtgtctccttcacattcggccctgacgttgtgcaccgttttgtgcagaaacacgat
atagacttgatctgtcgtgcgcatcagtgtgtggaagatgggtatgagttcttcgccaaa
cgaaagcttgtcacgttgttcagcgcaccgaattactgtggtgaatttgacaacgccggc
gctatgatgagtgttgatgagagcctgctttgctcttttcagattcttaaaccggctgag
aagaaaaaagcaattattaccagagggttcaaatcggacaggtctaatccatcttcaagt
cagcagaagaagcaatcatag

DBGET integrated database retrieval system